KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ012893
Entry
CpipJ_CPIJ012893  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K08775  breast cancer 2 susceptibility protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03440  Homologous recombination
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CpipJ_CPIJ012893
   03460 Fanconi anemia pathway
    CpipJ_CPIJ012893
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ012893
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ012893
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ012893
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    CpipJ_CPIJ012893
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     CpipJ_CPIJ012893
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     CpipJ_CPIJ012893
   FA (Fanconi anemia) pathway
    Downstream FA components
     CpipJ_CPIJ012893
SSDB
Motif
Pfam: BRCA-2_helical BRCA-2_OB3 BRCA-2_OB1 BRCA2
Other DBs
NCBI-ProteinID: EDS38093
VectorBase: CPIJ012893
UniProt: B0X0D2
AA seq 1747 aa
MEESIEHSPNQQRTRRSGYRSMVRKRHSRIWNESSERSVASPARRVSEESCPVAVSSNLI
YFDVNTERIELSDADPLAQAAVLEKANRLERESVVQPSQEFLRNVRNKFVKIDEVIEVDG
VPDFEEEKGPVQVKLEPVQPSTSKVKANYSYTQFDLDTQMLDILEGADMLAGLGSCPEQQ
ELKEWSSPPKEEVKNEPVERKHSKRRSKVEKNRRSKRYMDVRQSSFTRDVSIAPDFPTHP
ADLSASIVLDFESDSDADFVVDYSRIMSTPLRRRLAQIQNHIESPPQQVNRASIKRTFSR
RRKSPPIADSPQTPPPAVVRRLSMDSKASERNELSSDEEMAATQIDPEGLIPLEPSPEKE
SFNASLLIKANINQLSQFFSQSVDVPDKSKSTSREASFHTVAPLPSSPPISLSPTGSPRT
VNIEWLFRSETETSESKSSCGSSFEEEQEKDDEVVVKAEPDEALHRMLDDDDEFLVQLPA
TQKEVVPKEIVEKKVGEKVDGGCESGFVKRPQFIEPTHPPVSPEPGPSFANVPPPPPTFN
GVGGGFQTASGSGIRVSAASLAKARSIWHEEDAKLARDESWWKVLALEVDKCEQPVAMPP
KAAGGFQTARGGTIKISKEELVRAETRLQEVEREVEGGQREEPMSFGFKTAKGGGITVSK
EALEKAETRLQQVEREVERDFCEEPTSFGFKTAKGGGIAISKEALAKAQQRQQQFELVDE
GTCADQPVSFGFKTAKGGGIAISKEALAKAHQRQQQFELEAESATPTKTGENSALTRAQK
ILHQVEHQNESASRRKAFVPPVQKACEPAPEDSTSKRLPDDELDPETPLKRPKPNRPPLA
SFSTSTPNLTAASRRPEQPANDVEMADFFNDLDDRHFHELFCEEEEQEPPKDRRTRPPLR
QVRLASRFEECEEQQRPGSAQWDDSFGEVVAKLSSDGTLVGGAVKVAQQVLDARRLARER
QRECGDGRTKPEQERRPRLYEFVRRKKQQSGRISLRAFVGGERVGGGAGDGGSSRGVAER
IRMLSVDNVAEFKFEVEAFYGKQFAQENTTGIPLGDPDALIHVILDDNSHVGLPEFTSAF
LAAPGIDPTLVPSGWIVNAWKWILLKLASMERQLPKLFCDVTSPVNVLDQLLFRYHVEID
CAKRSVIRKMLEKDDVPGKRIVLFVSRVFRGQNPFEAEVELCDGWYPIRTVLDNPLTEAV
LGGRIVVGTKLMIQGAELLNLNEGCAPLDVPVDVRLRIHANSTRRAHWLAKLGLYQVPTS
FLVSCNHIADRGGLVVRLQLFVVRVYPLMYVDKSQGSSVLRSGRVERRRNLASDANRFDN
FQKLCSQVQKELESERAAVRRNGRMTVTRSTTTAELLEMVEAGLDLSYIEYDISATQRDA
IVDLQRRMQEETAQEVNRRVKTLMASGGNGNKRAIDGGASESGSRMVTPLLKVRVVDARK
PEKTLLMSIWGPPEDLGEVVQERRVLEVVNLTANGSKNGEIQLKAGKSTNYRVLDRMQFD
LPEGHFRRLTKIVDVDRSSFQPLYNEFDMVGVVVYVGNSDTKKFQIAYLADASMNLLGVH
FWSGIKEYAYEDVVKERSLLCVSNLQWRSFSQQSTIPSSYATEYTTFSEHPKADHFKEEL
RTLKATLESIDLEQFYRDCTEKITSAKDKKLHRSSSFNTPLRNSSGGGTPARTLLGSCNA
RTPNNYAPSPVGQPVSLQKRKMELLAAAYRSPPKKSPIVLRRNPRAGKNFKTPMRLEEKI
ERALAND
NT seq 5244 nt   +upstreamnt  +downstreamnt
atggaagaatccatcgagcacagcccgaaccagcagcggaccagaaggtcaggctaccgg
tccatggttcggaagcggcactcgcggatttggaacgagtccagcgagcgatcggtggcc
agtccggcgcggagggtttcggaggagagttgccccgttgcggtgagcagtaatttgatt
tatttcgatgtgaacaccgagcggattgagttgagcgatgcggatccgttggctcaggct
gcggtgctggagaaggccaatcgactggagcgggaatcggtggtgcagccgtcgcaggag
tttctgaggaatgtgcggaataagtttgtcaagatagatgaagtgattgaggtggatgga
gttccggatttcgaagaggagaaagggcccgtgcaggttaaactggaaccggtgcaaccg
agtacttctaaggtgaaggcaaattatagctacactcagttcgatttggacacgcaaatg
ctggacattttggagggcgccgacatgctggcagggctgggaagctgtcccgagcagcag
gagctgaaggagtggagcagtccgccgaaagaggaagtgaaaaatgaaccggtggaacga
aagcattccaaacgaaggtcgaaggttgagaagaatagacgatcgaaacggtacatggat
gttaggcagtcttctttcacgagagatgtttcaattgcacccgactttcccacacaccca
gccgacctcagcgcatcaatcgtgctcgacttcgagtccgactcggacgcagactttgtc
gtcgactactcgcgaatcatgtccactccgctgcgtcgccggctggcgcaaatccaaaat
cacatcgaaagtcccccgcagcaggtcaaccgcgccagtatcaaacgaaccttctccagg
aggcgaaagtctccaccaatcgcagacagtccccaaacgcctccacccgccgtcgttcga
cggctaagtatggacagcaaagcctccgaacgaaacgagctgtcctcggatgaggaaatg
gccgccacccagatcgacccggaaggtttgattccgctggaaccgagtccggaaaaggaa
agctttaacgcgagtctgctcatcaaggcgaacatcaaccagctgtcgcagtttttctcg
caatccgttgatgttccagacaagtcgaaaagcacttcccgggaggcatcgtttcatacg
gtggcacctctgccgtcgtcaccgccgatttcactctctcctaccggatcaccgcgaacg
gtgaacatcgaatggttgttcagaagtgagacggagacgtcggaatcgaagtcgtcgtgc
ggttccagtttcgaggaagagcaagaaaaagatgatgaagttgtagtcaaagcggaaccg
gacgaggctctgcatcggatgctggacgatgacgatgagtttcttgtgcaattgccggcc
acgcagaaggaagtggttccgaaggaaatcgttgaaaagaaagtgggcgagaaagtcgat
ggcggctgcgagagcggttttgtgaaaagaccccaattcatcgaaccaacccatccacct
gtctcaccagaaccaggtccctcattcgccaacgttcctccaccaccacccactttcaac
ggcgtcggcggtggcttccaaactgccagcggcagcggcattcgcgtgtcggcagcgtcc
ctcgccaaagcccgctcaatttggcacgaggaggacgccaagctcgctcgggacgaatcc
tggtggaaggtgcttgcgctcgaggttgacaaatgtgagcaacctgttgcgatgccacca
aaggctgctgggggatttcaaacggcacgcggtggaacgataaagatttcaaaggaggag
cttgttagggctgaaacgagacttcaggaggttgaacgggaggtcgaaggtggtcaacgg
gaggaacccatgtcgtttgggtttaaaactgccaaaggtggtggaattacagtttcgaag
gaagctctcgagaaagctgaaacgcgactccagcaggttgaacgagaggtcgaacgagat
ttttgtgaagaaccgacttcgtttggattcaaaaccgccaaaggtggtggaattgcaatt
tcgaaagaagctctcgcgaaagctcagcagagacagcaacagttcgagctcgtggatgag
ggcacatgcgcagatcaaccggtttcattcggattcaaaacagcgaaaggtggtggaatt
gccatttcgaaggaagctcttgcaaaagctcaccagaggcagcagcagtttgaactcgaa
gccgaaagtgcgacaccgacgaaaactggagaaaattccgctctgacgagagcccaaaag
attctccaccaggtggagcaccaaaatgagagtgcatcacggcgaaaagctttcgtacca
ccagtccagaaggcttgcgaacccgccccagaagattcaacctcaaaacgccttccagac
gacgaactcgatccggaaacgccgctaaaacgtccaaaaccaaaccgacctcctctggcc
agcttctcgaccagcaccccaaacctgacggcggcgtcacggcggccggaacaacccgcc
aacgacgtcgaaatggccgacttcttcaacgacctggacgaccgccactttcacgagctg
ttctgcgaggaggaggagcaagaacctccaaaagatcgccgcacgcgtcccccgctgagg
caggtccggctggccagtcgcttcgaggagtgcgaagagcagcaacggcccggaagtgcc
cagtgggacgacagctttggcgaggtggttgcgaagctgagttccgacggtacgttggtg
gggggagcggtgaaggtggcccagcaggtgttggatgcgaggcggctggcgagggagagg
cagcgcgagtgtggcgatgggaggaccaagccggaacaggagcggaggccgaggttgtac
gagtttgtcaggcggaagaagcagcagagtgggcggatcagtttgagggcgtttgtggga
ggggagagagtgggtggtggtgcgggtgatggtggtagcagcagaggtgtcgcggaacgg
ataaggatgctgagcgtggacaatgtggccgagtttaagtttgaggtggaggcgttttat
ggcaaacaatttgctcaggaaaacaccaccggaatccccctcggcgatccggacgccctg
attcacgtcatcctggacgacaacagccacgtcggtcttccggaattcacttccgccttc
cttgccgctcccggaattgaccccactctcgtaccttccggatggatcgttaacgcttgg
aagtggatcctgctcaagcttgcttccatggaacggcagctaccgaagctcttttgcgac
gtcacaagtccggtaaatgtgctcgatcagttgctgttccggtaccacgtggaaatcgac
tgtgccaaacgatcggtgattcggaagatgctggaaaaggacgacgtgcccggaaagcgg
atcgttctgtttgtgtcgcgggtattccgtggacagaacccgttcgaggcggaggttgaa
ctgtgcgacggatggtatccgattaggacggtgctggataatccgctgacggaggccgtc
ctcgggggacggattgtggtggggaccaagctgatgatccaaggtgccgagttgttgaac
ttgaacgagggttgcgcaccgttggacgttcctgttgacgttcggttacgaattcacgcc
aattcaacccgaagggcacactggttggccaagctggggctgtaccaggtgcccacaagc
ttcctggtgtcgtgcaatcacatcgccgatcggggtgggctcgtggtgcggctgcagctg
tttgtggtgcgcgtctatccgctgatgtacgtggacaagtcgcagggttcttcggtgctg
cggtcgggacgggtcgaaagaagacgcaatctcgcgagtgatgcgaaccgttttgacaac
tttcagaagctgtgcagtcaggtgcagaaagagctcgagagtgaacgggcggcggtgcgg
aggaatggacggatgacggtgacgaggtcgaccacgacggccgaattgttggagatggtt
gaggccgggctggatttgtcgtacattgagtacgacatctcggcgacgcaacgtgatgcg
atagtggacctgcagcgccgcatgcaggaggaaaccgctcaggaggtcaaccggcgcgtc
aaaacccttatggcaagtggtggcaacggcaacaagagggccatcgacgggggcgcgtcc
gaatcaggcagtcgcatggtcactcctctgctcaaagttcgcgtggttgacgcacggaag
ccggagaaaaccttgctgatgtcgatttggggtccaccggaagacttgggtgaggttgtg
caggagcgaagggttttggaggtggtgaatttgactgcgaatgggagcaaaaacggcgaa
attcagctgaaagcgggtaagagtaccaactatcgagtgctggaccggatgcagtttgat
cttcccgagggacattttcgaaggttgacgaagattgtagatgttgatcggagcagtttt
caaccgctgtacaacgagtttgacatggttggggtggtggtttacgtgggcaattcggac
acgaaaaagttccagatcgcttaccttgccgacgcaagcatgaacttgctcggcgttcac
ttctggtccgggatcaaagagtacgcctatgaagacgtggtaaaagaacgatcgcttctt
tgtgtctcaaatttacaatggcgatcgttcagccagcaaagcacgattcccagctcatac
gcgaccgaatacactaccttcagcgagcacccaaaggcggaccacttcaaggaagaactt
cgaacgctgaaagcgaccctcgaaagcatcgacctcgagcagttctaccgagactgcacc
gaaaaaatcacgtccgcgaaagacaaaaaacttcaccgatcgagcagtttcaacacgccc
ctccgcaactccagtggcggtggcactccggcgcgaactctgcttggcagctgtaacgcg
cggacaccgaacaattacgcgccctcgccagttggccaaccggttagtttgcaaaagcga
aaaatggaactactggcggcggcctatcggagtccgccgaaaaagtctccgattgttttg
cggaggaatccacgcgccgggaagaacttcaagacgccgatgaggttggaggagaaaata
gagcgggcgctcgcgaatgattaa

DBGET integrated database retrieval system