KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013041
Entry
CpipJ_CPIJ013041  CDS       T01079                                 
Name
(GenBank) DNA polymerase zeta catalytic subunit
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ013041
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ013041
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ013041
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    CpipJ_CPIJ013041
SSDB
Motif
Pfam: DNA_pol_B_exo1
Other DBs
NCBI-ProteinID: EDS38598
VectorBase: CPIJ013041
UniProt: B0X1H1
AA seq 184 aa
MVRDGSVTSFRIVSVDHYMHKPEPRFDSCYSEFRGSDVRQVPVVRLFGSTADGTHSCVHI
HGVFPYLYVPYDGASADSLAVDRLMYQIAGSLDKAINVSLGNANSAATHVFRIALVKGIP
IYGYHRKEHQFFKIFLYNPYFIRKATNLLMNGVIMSRVFQTYETHVPYILQFFIDYNLIF
VACD
NT seq 555 nt   +upstreamnt  +downstreamnt
atggtccgcgacggctcggtcacctcgttccggatcgtctcggtggaccactacatgcac
aagccggaaccgcgcttcgactcgtgctactccgagttccgggggtcggacgtgcggcag
gttccggtggtgcggctgttcggctcgaccgccgacggaacgcactcctgcgtgcacatc
cacggggtgttcccgtacctgtacgtgccgtacgatggggcgagcgcggactcgttggcc
gtggaccggctgatgtaccagattgccggcagcttggacaaggcgataaatgtgtcgctg
gggaacgcgaactcggcggcgacgcacgtcttccggatcgcgctggtgaaggggataccg
atttacggctaccaccggaaggagcatcagtttttcaaaatctttctgtacaatccgtat
ttcatccggaaggcgaccaatctgctcatgaacggcgtcatcatgtcccgggtgtttcag
acgtacgaaacgcacgtgccgtacattctgcagtttttcatcgattacaacctaatattc
gtggcctgtgactga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013042
Entry
CpipJ_CPIJ013042  CDS       T01079                                 
Name
(GenBank) DNA polymerase zeta catalytic subunit
  KO
K02350  DNA polymerase zeta [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ013042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ013042
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ013042
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    CpipJ_CPIJ013042
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol
Other DBs
NCBI-ProteinID: EDS38599
VectorBase: CPIJ013042
UniProt: B0X1E8
AA seq 1959 aa
MVRDGSVTSFRIVSVDHYMHKPEPRFDSCYSEFRGSDVRQVPVVRLFGSTADGTHSCVHI
HGVFPYLYVPYDGASADSLAVDRLMYQIAGSLDKAINVSLGNANSAATHVFRIALVKGIP
IYGYHRKEHQFFKIFLYNPYFIRKATNLLMNGVIMSRVFQTYETHVPYILQFFIDYNLYG
MSLMNVPTAAVQERGDGEGQLAKMSTSEYEVDILAVDILNRATMEEEKRSPYANPGIASI
WNDEQARRRLLEMDQPEALSLSQSGKVEIVTESDRFYRSLLAAKIASESRPNRSDPDDSK
RMKPPVSFLPSEAAEDEPLLDASCVQDHKNFTQQASFDQSNTTYNFDLSQVDEERIISMS
QHPDATFADEDHELLDIMKELEGRDQEDGDSLLAPLTQQSQAKTSSSQGSSSKRLNATLG
GDLEAVSLVEGEEKVEAMDSDDEFLLDYTLKTEGNAFLNDSDDEFLESSVIPQLDGADGE
IPSAKRTRHNGVNGHGPMQKRVRLTNGVETKKVPLANGLPRTRKAGKMEEVVLNGVVANG
VDEEGGSSSRKKVKVDDEPKMKPLQIRIMDLANLAESEFGSSKGEPQSMTNGSSSKSSDV
PQMKQLQIRIPRMDFSNYPLPSTSSSPSRDTSPYDEFRLAREYDLVNNWDPQEGLSRGQS
SGRRGRGRGRSKKSRPYRRKKLEPEPAEQEPEIDLVLSQQFQDIIKLSPKVLIKPINNSE
ATFVTDEVSRCSQERPDAELPEIAQVSGRTQSHTPDGGEGCTIVDDAEEEEENDLNIKSF
YEQTLAFDDFDELGSGSDESVSEFRFPILKDDSAKISVTLEEKPPSFEDALEALQKFIIP
QVINREPFYSNPDDVTGRKEVGHVVLNIGGSSLNDLEEFKSVVPGLGSINQARYEKLSSI
YGEDLHEALGVSATRPNAARLKELLATEAPVVIHSAARPPSKHEAKVWLEAMKSIRVEKE
TVDNGQDSPIKVKKMQAIMAGGDAEQSNTQQKPRIDHDSTLNLSSLISDDNVRSSGVDSS
ATKSLVSKILSMNTRSSPARADSPTMFSPSAEPNQLELLSYSARRKRRPKARLSLSAASG
NISAATPRNNNTYGFKVSFENLQKAKATCEYNHLAVMSVELHVQTRGDLRPNPDIDPISA
VFYRIHNDVPADHRRAPSVCGIILNRQSSSGVVSDAVKYNQCSYTADVVVVGSERELYEK
FLVLISFWDPDIFAGYEIEAGSWGYLIQRGYALEMNLMKMLSRVPTAEKVHVSEEEEQDL
LEMHEYSAGLKIPGRILLDIWRLMRHEIALTSYTFENMVYHILHRRVSRHSFRFLTRLWN
KSYTKWVVLEYYLERVNGNLELLQQLDLIGRTAELAKLFGIQFYEVLSRGSQFRVESMML
RIAKPRNFVSVSPSIQQRAHMRSPEYLPLILEPNSRFYADPLIVLDFQSLYPSIIIAYNY
CFSTCLGRVEHLGQSEPFEFGASQLRLSPRMLKVLVEKNLVTVSPCGAVFVKSSVREGIL
PRMLNEILTTRLMVKASMKLHKENSILQRVLHSRQLGLKLIANVTYGYTAANFSGRMPCV
EVGDSVVSKGRETLERAIKLVESTERWGAKVMYGDTDSMFVLCPGRTRQDAFKIGEEIAE
AVTRDNPPPVKLKLEKVYQPSILQTKKHYVGYMYESPDQEKPVYEAKGIETVRRDGCPVV
SKMLEKVLRILFETQDVSRVKEYTCRQFTKILEDRVNVQDYIFAKEFRGQDGYKPGACVP
ALELTRRWKAVDPRREPRRGERVPYVIINGPPLVPLIRLVRSPDELLADPGLKINSNYYI
TKAIIPPLNRCLLLIGADVNQWYNDLPRKVLMLHNTGGSGSGKSKRSLLASELQLPKKST
ISQYFSTTSCVGDCGNQTHRGVCGECLGRPQRTVSYVMDKINRLERRVELGEKMCKSCCQ
RTFETACTSLDCPVLFVINRRTREHGQVQYYRDLLEEMF
NT seq 5880 nt   +upstreamnt  +downstreamnt
atggtccgcgacggctcggtcacctcgttccggatcgtctcggtggaccactacatgcac
aagccggaaccgcgcttcgactcgtgctactccgagttccgggggtcggacgtgcggcag
gttccggtggtgcggctgttcggctcgaccgccgacggaacgcactcctgcgtgcacatc
cacggggtgttcccgtacctgtacgtgccgtacgatggggcgagcgcggactcgttggcc
gtggaccggctgatgtaccagattgccggcagcttggacaaggcgataaatgtgtcgctg
gggaacgcgaactcggcggcgacgcacgtcttccggatcgcgctggtgaaggggataccg
atttacggctaccaccggaaggagcatcagtttttcaaaatctttctgtacaatccgtat
ttcatccggaaggcgaccaatctgctcatgaacggcgtcatcatgtcccgggtgtttcag
acgtacgaaacgcacgtgccgtacattctgcagttcttcatcgattacaacctgtacggg
atgagcctgatgaacgtcccgacggcggcagttcaggagcgaggcgacggagaaggtcag
ctggcaaagatgtccacgtccgagtacgaggtcgacatcctggcggttgacatcctgaac
cgagccacgatggaggaggagaagcgttcgccgtacgctaatccgggaatcgcctcgatt
tggaacgatgaacaagcgagaaggagattactcgaaatggaccaaccggaagcgctcagt
ttatcgcagagcgggaaggtcgaaatcgtgaccgagagcgaccggttttaccggtccctg
ctcgcagcaaaaatagcttccgaaagccgtccaaatcgctccgacccggacgactcgaaa
cgcatgaaacctccggtttcgttcctcccgtcggaagccgccgaagacgaaccgctgctg
gacgcgtcctgcgtccaggaccacaagaacttcacccaacaagcttccttcgaccagtcc
aacacgacgtacaacttcgacctgagtcaggtcgacgaggagcgcatcatcagcatgtcg
cagcatccggacgcgacgttcgccgacgaagatcacgagctgctggacattatgaaggag
ctggaaggtcgcgaccaggaggacggggacagcctgttggccccgttgacgcagcaaagt
caggcgaaaaccagttcctcacaaggaagcagcagcaagcgattgaacgccacgttgggc
ggagatctggaggcggtttcactcgtggaaggcgaagaaaaggtcgaagcaatggactcc
gacgacgagttcctgctagattacacactgaaaacggaggggaacgcctttctcaacgac
agtgacgacgagttcttggagtcgagcgtgattccacagctcgacggtgcggacggagaa
attccgagtgcgaaacgaacccggcacaacggcgtgaacggacacgggccgatgcagaag
cgggttcggttgacgaacggagttgagacgaaaaaagttcctctcgcgaatgggttgcca
cggacgagaaaggcgggcaagatggaggaggttgtgctgaacggggttgttgcgaatgga
gttgatgaagagggaggttcttcaagcaggaaaaaggttaaggttgatgacgaacccaag
atgaaaccgctgcaaataagaatcatggaccttgcaaacctcgccgaatcggagtttggg
tcttccaaaggggaacctcagagcatgacaaatggttccagcagcaagtcgagcgacgtg
ccccaaatgaagcagttgcaaatacgaattccccgaatggacttctcgaactacccgctt
ccgtcaacgtcatcatccccctcccgggacacctccccgtacgatgagttccggctggca
cgcgagtacgacctcgtcaacaactgggacccccaggagggactttcgcgcggtcagtcc
tccggccgacgaggtcgcggccgcggccgctccaaaaagtctcgaccatatcggaggaag
aagctggagccggaacccgctgagcaagaaccggaaattgatctcgttctgtcccagcag
tttcaggacattatcaaactctcgcccaaggtgctgatcaagccgatcaacaactcggag
gcgacgttcgtgacggacgaggtgtcgcgatgctcgcaggaacggccggatgcggagctg
ccggagattgcgcaggtttcgggtcgaacgcagtcgcacactcccgatgggggtgaaggt
tgtacgatcgtcgatgatgcggaagaagaggaggagaatgacctcaacattaagagcttc
tacgagcagacgctcgcgtttgacgactttgacgagcttgggtcggggtcggatgaaagc
gtgagcgagttcaggtttccgatcttgaaggacgacagcgcgaagatctccgttacgctc
gaggagaagccgccttcgttcgaggacgctctggaagcgttgcaaaagttcatcataccg
caggtcatcaaccgcgagccgttctacagcaatccggacgacgtgacgggtcgcaaggag
gtcggccacgtcgtgctgaacatcggcggaagcagcttgaacgacctggaggaattcaaa
agtgtcgtgcccgggttgggctcgatcaaccaagcacgctacgagaagctcagctcgatc
tacggtgaagacctgcacgaagctttgggcgtttcggcgacgcgacccaacgccgctcga
ctcaaagaactgctcgcaacggaagcacccgtagtaatacactccgcggcgcgacctccg
tccaaacacgaagccaaagtgtggctcgaggcgatgaagagcatccgcgtcgagaaagaa
acggtcgacaacggccaggacagtcccatcaaggtcaaaaagatgcaagccatcatggcc
ggcggagacgcggagcagtcaaacacccagcaaaagcctcgaattgaccacgacagcacg
ctcaacctgagttccctaatcagcgacgacaacgtgagatcttccggagtcgactccagt
gcaacgaaatcgctcgtatccaaaattctaagcatgaacacgcgatcgtcccccgccagg
gcggactccccaaccatgttctccccgtcagccgagccgaaccagctggaactgttaagc
tacagtgcccgtaggaagcgaagaccaaaggcgcgactgtcgctcagtgccgcaagcggc
aacatatcggccgccacaccgcgcaacaacaacacgtacggcttcaaggtcagcttcgaa
aacttgcaaaaggccaaagcgacgtgcgagtacaaccacctggccgtcatgtccgtcgag
ctgcacgtccaaacgcggggtgacctgcgccccaacccggacatcgatcccatttcagcg
gtcttttaccgcatccacaacgacgtcccggcggaccatcggagggcaccctccgtgtgc
ggcatcatcctgaaccggcagagtagtagcggtgtagtttcggacgcggtcaagtacaac
cagtgcagctacacggcggacgttgtggtggtggggagcgagcgcgagttgtacgagaag
tttctggtgttgatttcgttttgggacccggacatctttgcggggtacgagattgaggcg
gggtcgtggggctatttgattcagcgaggttacgcgctggagatgaacttgatgaagatg
ttgtcgcgggtgccgacggcggagaaggtgcacgtgagtgaggaggaggagcaggatttg
ctggagatgcacgagtacagtgcggggttgaaaattccggggcggattttgttggatatt
tggcggttgatgaggcacgagattgcgttgacttcttatacgtttgagaacatggtgtat
cacattttgcatcgacgagtttcgagacattcgtttcggtttttgacgcggttgtggaac
aagtcgtacacgaagtgggtcgtgttggagtattatctggagcgggttaatgggaacttg
gagctgttgcaacagctggacttgattgggaggactgcggagttggcgaagctgtttggg
attcagttttatgaggtgctctcgcgggggtcgcagtttcgggtggagagtatgatgttg
cggatcgcaaagccgaggaactttgtgtccgtttctccgagcattcagcagcgtgcccac
atgcgatctccggaatatctcccgctgatcctggagcccaactcgcggttctacgccgat
ccgttgatcgtgctggactttcaaagtctctatccgagcatcatcatcgcgtacaactac
tgcttctcgacgtgtctcggtcgggtcgagcacctgggacagtcggaaccgttcgagttc
ggtgcgtcccagctgcgactgtcgccacggatgttgaaggtcctcgtggagaagaacctc
gttacggtgtccccttgtggagcggtcttcgtgaaatccagcgtccgagaaggcatcttg
ccgcgaatgctgaacgaaatcctgaccacgcgactcatggtgaaggcgtcgatgaagcta
cacaaagaaaacagcatcctgcagcgagttcttcactcacggcagctcggcctaaagctg
atcgcgaacgtcacgtacggttacacggctgcgaacttcagcggtcgaatgccctgcgtc
gaggttggcgacagcgtcgttagcaagggtcgtgaaactctcgagcgagcgatcaaactg
gtcgaatctacagaacgatggggcgccaaggtcatgtacggcgatacagactccatgttc
gtcctctgcccaggtagaacccgccaagacgcgttcaagatcggcgaagaaatcgccgaa
gccgttacccgagacaacccacctcccgtgaagctcaaactcgaaaaggtctaccaaccc
tcgatcctacaaaccaagaagcactacgttggctacatgtacgaatcccccgaccaagaa
aaacccgtctacgaagccaaaggcatcgaaacggttcgccgcgacggctgccccgtcgtc
agcaaaatgctcgaaaaggtccttcgaatactgttcgagacgcaggacgtctcgcgcgtc
aaagagtacacctgccgccaattcaccaagatcctcgaagatcgcgtcaacgtccaagac
tacatcttcgccaaagaattccgcggccaggacggctacaaaccgggcgcttgcgtcccc
gccctagagctaacccgccgctggaaagcagtcgacccccgccgtgaaccacgccgcggc
gaacgcgtcccctacgtcatcatcaacggaccccccctcgtcccccttatccgcctcgtt
cgaagccccgacgaactgctcgccgaccccggactcaaaatcaactccaactactacatc
accaaagcgatcattccaccgctgaaccgctgtctgctcctgatcggagccgacgtcaac
cagtggtacaacgatctcccgcgaaaggtccttatgctgcacaacaccggcggatccggt
agcggaaaatccaagcgttccctcctggcaagcgagctgcaactcccgaagaagagtaca
atttcgcagtacttttcgacgaccagctgcgtgggggattgtggcaaccagacgcatcgt
ggggtttgtggcgagtgcctcggtaggccccagcggacggtgagctacgtgatggacaag
atcaaccggctggagcggagggtggagttgggggagaagatgtgcaaatcctgctgccag
cgaacgttcgaaacggcgtgcacctcgctggactgtccggttttgtttgtgatcaaccgg
cgaacccgcgagcacggccaggttcagtattatcgcgacctgcttgaggaaatgttctaa

DBGET integrated database retrieval system