KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013688
Entry
CpipJ_CPIJ013688  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K15078  structure-specific endonuclease subunit SLX1 [EC:3.6.1.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ013688
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ013688
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-
     CpipJ_CPIJ013688
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     CpipJ_CPIJ013688
SSDB
Motif
Pfam: GIY-YIG T5orf172 MUG113
Other DBs
NCBI-ProteinID: EDS39501
VectorBase: CPIJ013688
UniProt: B0X2Z9
AA seq 66 aa
MAAVQEIEDFYGVYLLVSKSPNPKFGGRTYIGYTVDPNRRIKQHNSGQDGGGAKRTSNRG
PWYVIN
NT seq 201 nt   +upstreamnt  +downstreamnt
atggccgccgtgcaggagattgaagatttttacggcgtgtatctgctggtcagcaaaagt
cccaatccgaagtttggcggccgaacctacatcggctacacggtggatcctaaccgtcgg
attaaacagcacaacagcggccaggatggcggtggggcaaaacggacatcgaaccgggga
ccgtggtatgttattaattag

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013689
Entry
CpipJ_CPIJ013689  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K15078  structure-specific endonuclease subunit SLX1 [EC:3.6.1.-]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ013689
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ013689
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-
     CpipJ_CPIJ013689
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     CpipJ_CPIJ013689
SSDB
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Other DBs
NCBI-ProteinID: EDS39502
VectorBase: CPIJ013689
UniProt: B0X300
AA seq 289 aa
MVMIIHGFPNNLSALRFEWAWQQPKVSRRLKAIPELHKKQRKESNFEYNFRILTEMLRIG
PWNRLPLTVRWLVDDFHREFEVGKAPPMHMPICFGRVKKVPKRGKVAKKSGGRRRAAQKP
STVPTAKNSKSKQIAVNYDLDVDEYDLLVMGADATASENASKPEEEEDTVGPDDDGITIS
SDEDEEEPKSNDADLCVICNGAIGASNGGGFALRCVRPRCSMVCHIECLAGKCLEPGQYV
PVSGVCPVCDGNFLWGDLIRKANGCSDLVEDSGNTTMLEVDDVSESEGE
NT seq 870 nt   +upstreamnt  +downstreamnt
atggtgatgatcatccacggcttcccaaacaacctttccgctctaaggtttgaatgggcc
tggcagcagccgaaggtctcccggcgactgaaggcgatcccggagctgcacaagaaacaa
cgcaaggaaagcaacttcgagtacaactttcgcattctcaccgagatgctgcggatcggg
ccatggaatcggctgcccctcaccgtgcgctggctcgtggacgacttccaccgcgagttt
gaggttggaaaggcacccccgatgcacatgccaatttgctttggccgtgtgaagaaagtg
cccaaaaggggaaaagtggccaaaaagtccggcggccggcgtcgcgctgcccagaagcca
agcacagttccaacggcgaagaatagtaaaagcaaacaaatcgccgttaattacgatctg
gacgtcgacgagtacgatctgctcgtaatgggggcagacgctactgcttccgagaacgct
tctaaaccggaggaggaggaggacacggtcgggccggacgatgacggcataaccatcagt
tcggacgaagatgaagaggagccaaaatccaacgatgctgatttgtgcgtcatttgtaac
ggtgcgattggagcgtccaacgggggagggtttgccctgcggtgtgtccggccccgctgc
tccatggtgtgtcacatcgagtgtctggccgggaagtgcctcgagccgggacagtacgtg
cccgtgtcgggcgtttgtcccgtgtgcgacgggaactttctgtggggagatctgattcgg
aaagccaacgggtgcagcgatttggtggaagattcgggaaatacgaccatgctggaagtg
gacgacgtttccgaaagtgagggagaataa

DBGET integrated database retrieval system