KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ013742
Entry
CpipJ_CPIJ013742  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10610  DNA damage-binding protein 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03420  Nucleotide excision repair
cqu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ013742
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ013742
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ013742
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ013742
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     CpipJ_CPIJ013742
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      CpipJ_CPIJ013742
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      CpipJ_CPIJ013742
SSDB
Motif
Pfam: MMS1_N CPSF_A
Other DBs
NCBI-ProteinID: EDS40298
VectorBase: CPIJ013742
UniProt: B0X4E5
AA seq 1138 aa
MAHNYIVTAQKPTAVTACVTGNFTSTTDLNLIVAKSSRLEIYLVTPEGLRPIKEVGINGK
IAVMKLFRPAEAQKDLLFILTHRYNAMILACQVQGDDIEIITKAHGNVADRVGKPAETGI
LAVIDPKARVIGMRLYEGLFKIIPLDRDTHELKATSLRMEEMHVQDVEFLYGTAHPTLIV
IHQDLNGRHIKTHEINLKDKDFTKIAWKQDNVETEATMLIPVPTPLGGAIVIGQESVVYH
DGDSYVAVAPAIIKQSTINCYARVDSRGFRYLLGNMIGHLFMMFLETEENTRGQLTVKDI
KVELLGEITIPECITYLDNGVLFIGSRHGDSQLVKLNTTAAASGAYVTVMETFTNLAPII
DMCIVDLERQGQGQMITCSGSYKEGSLRIIRNGIGIQEHACIDLPGIKGMWALRVGIDDS
PYDNTLVLSFVGHTRILMLSGEEVEETEIPGFLSDQQTFYCANVDFGQIIQVTPMTARLI
SCDNKSMICEWKPPDDKRIGVVACNSCQMVCATARDIYYIEIEAGKLVHKSTVTLDYEVA
CLDISPLDEPATRSELVAVGLWTEISACILRLPNLEFVHKEKLGGEIIPRSILMACFEGI
IYLLCALGDGSMFYFVVDKTTHRLTDQKKVTLGTQPTILKTFRSLSTTNVFACSDRPTVI
YSSNHKLVFSNVNLKEVNHMCSLNAESYQDSLALATKNSVILGTIDEIQKLHIRTVPLGE
SPRRIAYQEASQTFGVITVRMDIQDSSGLTPSRQSASTQTSNVTSSSNMGLLKPGASNTE
FGQEVEVHNLLIIDQNTFEVLHAHQFMQTEYVLSLISAKLGNDPATYYIVGTAMVNPEER
EPKVGRIIIYHYADGALTQVSEKEIKGACYSLVEFNGRVLATINSTVRLYEWTDDKDLRL
ECSHFNNVLALYCKTKGDFILVGDLMRSITLLQYKQMEGSFEEIARDYQPKWMTAVEILD
DDAFLGAENSNNLFVCLKDSAATTDDERQQMPEVAQFHLGDMVNVFRHGSLVMQNIGERT
TPTSGCVLFGTVSGAIGLVTQIPPDYYEFLRKLQENLTNTIKSVGRIDHTYWRSFHTEMK
TENSEGFIDGDLVESFLDLTREKMHEAALGLQIDVEGTKKEANVDDIIKIVEDLTRIH
NT seq 3417 nt   +upstreamnt  +downstreamnt
atggcccacaactacattgtgaccgcccagaagccgacggcggtcacggcttgcgtaacg
ggcaattttacgtcgacgactgacctaaatttgattgtggccaagagctcccggctggag
atttacctggtgacgccggagggcctgcggccaatcaaggaggtcggcatcaatggcaag
attgcggtcatgaagctgttccggccggcggaagcccaaaaggacctgctcttcatcctg
acgcaccgctacaacgcgatgatcctggcctgccaggtgcagggcgacgacatcgagatc
atcaccaaggcgcacggcaacgtggcggatcgcgtcggcaaaccggccgagacgggcatc
ctggcggtgatcgatccgaaggcgcgcgtcatcgggatgcggctgtacgagggtctgttc
aagatcatcccgctggacagggacacgcacgagctgaaggcgaccagcctgcggatggag
gagatgcacgtgcaggacgtggagtttctgtacgggacggcccatccgacgttgatcgtg
attcatcaggacctgaacgggcgccacatcaagacgcacgagatcaacctgaaggataag
gactttacgaagatcgcctggaagcaggacaacgtggagacggaggcgaccatgttgatt
ccggtgccgacgccgctcggaggggcgatcgtgattgggcaggagtcggtcgtttatcac
gacggcgacagttacgtggcggttgcgccggcgatcattaagcagagtacgattaattgc
tacgcccgggtcgacagcagaggattccggtatttgttgggaaatatgattggacatttg
tttatgatgttcttggagacggaggaaaacacccgcggccagctgacggtgaaggacatc
aaggtcgagctgctcggggagattacgatcccggagtgtattacgtacttggataacgga
gtgttgtttatcgggtcccgtcacggcgattcgcagctcgtcaagttgaacacgaccgcg
gcggctagtggcgcgtacgttacggtgatggaaacgttcaccaatttggccccgatcatc
gacatgtgcatcgtggatttggaacggcagggccagggccagatgatcacctgctcgggc
agctacaaggagggctcgctgcgtataatccggaacggaatcggcatccaggagcacgct
tgcatcgatctccccgggatcaagggcatgtgggcgctccgcgttggcatcgacgacagt
ccgtacgacaacacgctggtgctttcgttcgtcggtcacacccgcattttgatgctttcc
ggtgaggaagtggaggaaacggagattcccggcttcctcagcgaccagcagacgttctac
tgcgccaacgtggactttggccagataatccaggtgacgccgatgacggcgcggctcatc
tcgtgcgacaacaagtcgatgatctgcgagtggaagcctccggatgataagcgcatcggt
gtggtcgcgtgcaactcgtgccaaatggtttgcgccactgcccgggacatttactacatc
gagatcgaggctggcaagctggtccacaagagcaccgtaacgctggactacgaggtggcc
tgtctggacatttctcccctggacgaacccgcaacgcggtccgaactggtcgccgttggt
ctttggacggaaatttccgcgtgtattttgcgcctgccaaacctggagtttgtacacaaa
gaaaagctcggcggagaaattatcccgcggtcgatcctgatggcgtgcttcgagggcatc
atctatctgctgtgcgccctcggcgatggctcaatgttttactttgtggtcgataaaacg
acccaccggctaaccgaccagaagaaggtcacgctcggaacgcaacccaccatcctgaag
acgttccggtcactttcgacgacgaacgtgttcgcctgctcggaccgcccaacggtcatc
tacagctcgaaccacaagctggtcttttcgaacgtcaacctgaaggaggtcaaccacatg
tgctcgctgaatgccgaatcctaccaggattcgcttgcgctggccaccaagaactcggtc
attctgggaacgatcgacgagattcaaaagctgcacatccggaccgttccgctgggcgaa
tccccgcgaagaatcgcctaccaggaggcatcgcaaacctttggcgtaatcaccgttcgt
atggacatccaagactcgagtggactaaccccgtcccgacagagcgcctccacgcaaact
tcgaacgtaacttcatcgagcaacatgggtctgctgaagcccggcgccagcaacaccgag
tttggccaggaggtcgaagtccacaacttgctcatcatcgaccagaacacgttcgaagtg
ctgcacgcgcaccagtttatgcaaacggagtacgtcctgtcgctgatttccgccaagctg
ggcaacgacccggccacgtactacatcgtcggcacggccatggtcaatccggaggagcgc
gaaccgaaagtaggtcgcatcatcatctaccactacgcggacggtgcgttgacgcaggtc
agcgagaaggaaatcaagggcgcttgctattcgctggtcgagttcaacggtcgcgttctc
gccaccatcaactcaacggtccggctgtacgagtggaccgacgacaaagacctgcgcctc
gagtgcagccactttaacaacgtgctcgcgctgtactgcaaaaccaagggcgatttcatc
ctcgtcggtgacctgatgcggtccatcacgctgctgcagtacaaacagatggagggcagc
ttcgaggagattgcccgcgactaccagcccaagtggatgacggcggtggagatcctggac
gacgatgcgttcctcggggccgaaaacagcaacaatctgtttgtctgtctcaaggacagc
gcggccaccacggacgacgagcggcagcagatgcccgaagtggcccagttccacctcggt
gacatggtcaacgtgttccggcacggttcgctcgttatgcagaacattggcgagcggaca
acgcccaccagcgggtgcgtcctgttcggaaccgtcagcggtgccatcggactcgtcacc
caaattccgcccgattactacgagtttttacgcaaactgcaggagaacctcaccaacacg
atcaaatcggtcggtcggatcgatcacacgtactggcgcagcttccacaccgagatgaag
acggaaaattcggagggtttcatcgacggcgacctggtggagagtttcctcgatttgacg
cgcgaaaagatgcacgaggccgcccttgggctgcagatcgacgtcgaaggcaccaagaag
gaggccaacgtcgacgacatcatcaaaattgtcgaggacctgaccaggatacattag

DBGET integrated database retrieval system