KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014043
Entry
CpipJ_CPIJ014043  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10802  high mobility group protein B1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03410  Base excision repair
cqu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CpipJ_CPIJ014043
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CpipJ_CPIJ014043
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cqu03036]
    CpipJ_CPIJ014043
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ014043
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cqu04147]
    CpipJ_CPIJ014043
Chromosome and associated proteins [BR:cqu03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    CpipJ_CPIJ014043
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     CpipJ_CPIJ014043
   MMR (mismatch excision repair)
    Other MMR factors
     CpipJ_CPIJ014043
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CpipJ_CPIJ014043
SSDB
Motif
Pfam: HMG_box_2 HMG_box DUF3974 Ndc1_Nup CCDC53 Med15
Other DBs
NCBI-ProteinID: EDS39811
VectorBase: CPIJ014043
UniProt: B0X3B9
AA seq 372 aa
MANSFQNPVTSLSGVTVSTSNSPYDYRLGMSAAAASGVVSRPGDPPTMASTAPTTQWWYP
GGQNAIDNSLQQQQQQQQQQQQQQHQVQQQQQSQQQQSQHHQQAHNQQTQSAQNNAIQSK
IGGGGGGGGGGNRPVKDNKPRGRMTAYAFFVQTCREEHKKKHPEEQVIFAEFSRKCAERW
KTMLDKEKQRFHEMAEKDKARYELEMQSYVPPKGTVVGKGKKRKAFKDPNAPKRSLSAFF
WFCHEERNKVKALNPEYGVGDIAKELGRKWSDMDAEVKSRYEQMAEKDKARYEAEMTEYK
LKCKNEQGGQVQGQALNLGGLQNLHVQQAAAAQLQAQVQQQLAAQAAAAAAAAAAHHADD
DDDDEGDEDDNE
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggccaacagttttcagaacccggtcacgagtctgtccggcgtcacggtgtccacctcg
aacagcccctacgactaccgtctcgggatgagcgctgcggcggcgtccggcgtcgtgtcg
aggcccggcgatccgccaaccatggccagcacagccccaacgacccagtggtggtacccc
ggtggacagaacgccatcgacaacagtctgcaacagcagcagcagcaacaacagcaacag
cagcaacaacaacatcaggtacaacaacaacaacaaagccaacagcaacagagccaacat
caccaacaagctcataaccaacagacccaatcggcgcaaaacaatgcgatccagagcaaa
ataggcggcggcggagggggcggaggcggcggcaaccggcccgtcaaggacaataagcca
agggggcgcatgacagcgtatgcctttttcgtacaaacctgccgcgaggagcacaagaag
aagcacccggaggagcaagtcatattcgccgagttctcgcggaagtgcgccgagcggtgg
aagacgatgctggacaaggaaaagcagcgcttccacgagatggccgagaaggacaaggcg
cggtacgagctggagatgcagagttacgttccaccgaagggcaccgtcgtcggcaagggc
aagaagcggaaagcgttcaaggacccgaacgcgcccaagcggtcactctctgcgttcttc
tggttctgccacgaggagcgaaacaaggttaaggcactgaaccccgagtacggcgtcggc
gacatcgcgaaggagctcggccggaagtggtccgacatggacgccgaggtcaagtcccgg
tacgagcagatggcggagaaggacaaggcgcggtacgaggcggaaatgaccgagtacaag
ctaaagtgcaaaaatgagcagggcggccaggtgcaaggccaggcgctcaacctcggcggt
ctccagaacctgcacgtgcagcaggcggcagcggcccagctgcaggcccaggtccagcag
cagctggcggcccaggcagcggcagcggctgcggcggcggcggcccatcacgctgacgac
gatgacgatgacgagggggacgaggatgataacgagtaa

DBGET integrated database retrieval system