KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014111
Entry
CpipJ_CPIJ014111  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K15361  WD repeat-containing protein 48
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ014111
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ014111
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     CpipJ_CPIJ014111
SSDB
Motif
Pfam: WD40 DUF3337 NBCH_WD40 ANAPC4_WD40 Ge1_WD40 WD40_like
Other DBs
NCBI-ProteinID: EDS39433
VectorBase: CPIJ014111
UniProt: B0X2V9
AA seq 670 aa
MVSFVIRDAEEKRHRNGVNALQLDPVNGRLYSAGRDAIIRVWNSTQTSSQEPYIQSMEHH
NDWVNDIVLCCGGRNLISASCDTTVKVWNAHKGFCMSTLRTHRDYVQALAYAKDREQVAS
AGLDKAIFLWDVNTLTALTASNNTVTTSSITGSKDSIYSLAMNPSGTIIVSGSTENTLRI
WDPRTCNKIAKLKGHTENVKALVVSEDGTQVVSGSSDGKIKLWSIGQQRCIQTISVHSEG
VWALLMTDNFSHVISGSRDKKIVMTELRNPTNSVLICEERAPVLSLCYNIDQTGIWATTW
NSDVRCWKLNKTDKLSNYSYSSNSSINSGGGGDGTPVTNSASNATPASAGKGYEVACIKG
GAAIKKYHVLNDKRFMLTKDSEQNVAIYDVLKVKKVEDLGKVDYEEEIKKRSQRVHVPNW
FTVDLKTGMPTIVLGQDEVDCFAAWVSAEAGLPEHAESGSDPKVNYGSLLLQALLEYWKP
PPPHHHLQGGVPDMENGCDGDIRGNEYFIVPKHTPIIFSEVGGRNVCRLLVKDAAGETES
ALLSETVPSWVTNVVIERTIPKFIKLPFYLLAHPSMLKQDRSKKERLIANEFIQCRKVCE
HVLEKVLGADLPGGGGGSSTGGGGNSNSSQNNSQSDANSEGSQVPAEERIELLCNDVNNE
DYGKNIHLNT
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggtgtccttcgtgatccgggacgccgaggagaagcgccaccgcaacggcgtcaacgcg
ctccagctcgatccggtcaacgggcggctctactcggccggtcgcgatgccatcatccgg
gtgtggaactcgactcagaccagctcccaggagccgtacatccagagcatggaacaccac
aacgactgggtcaacgacatcgtgctgtgctgcggcggccgaaacttgatcagtgccagt
tgcgacaccacggtcaaggtgtggaacgcccacaagggtttctgcatgtcgacgctgcga
acccaccgggactacgtgcaggcgttggcctacgccaaggaccgggagcaggtcgctagc
gccgggctggacaaggccatcttcctgtgggacgtgaacacgctgacggcgttgaccgcg
tcgaacaacaccgtgacgacgtcgagcattaccggctcgaaggactcgatctacagcctg
gcgatgaacccgtccgggacgatcatcgtgagtggttctaccgagaacacgttgcgcatt
tgggacccgcggacgtgcaacaaaatcgccaaacttaagggtcacacggagaacgtgaag
gctctggtcgtgtccgaggacggtacgcaggtcgtgtcgggtagctcggacggcaagatc
aaactgtggagcatcggccagcagcgctgcattcagacgatttcggtccactcggagggc
gtgtgggcgctgctgatgacggacaacttttcgcacgtaatctccggcagccgggacaag
aagatcgtcatgacggaactgcgcaacccaacgaatagtgtgctgatctgcgaggagcgg
gcaccggtgctgagcctctgctacaacattgaccaaacggggatctgggccaccacgtgg
aacagtgacgtgcgctgctggaagttgaacaaaacggacaaactgagcaactacagctac
agcagcaacagcagtattaacagcggaggaggcggcgatgggacgccggtgaccaactcg
gcgtccaacgcaacgccggcaagtgccggaaagggttacgaggtggcgtgcattaaggga
ggggcggcgatcaaaaagtaccacgtgttgaacgataagcggttcatgctgacgaaggac
agcgagcagaacgtggcgatctacgacgtgctgaaggtgaagaaggtcgaggatttgggc
aaggtggactacgaggaggagattaagaagcgcagccagcgggtgcacgtgccgaactgg
ttcacggtggacctgaagacggggatgcccacgatcgtgctcggccaggacgaggtggac
tgcttcgcggcgtgggtctccgccgaagccggcctgcccgagcatgccgagtccgggtcc
gatcccaaggtcaactacggcagtctgctgctgcaagccctgctcgagtactggaagcct
ccgccgccgcaccaccacctgcagggcggcgtcccggacatggagaacggctgcgacggg
gacatccgcgggaacgagtactttatcgtgcccaaacacacgcccatcatcttcagcgag
gtcggcggccggaacgtgtgccggctgctggtgaaggatgccgccggtgaaaccgagagt
gccctgctcagcgaaaccgtgccgtcctgggtcacgaacgtcgtcatcgagcggaccatc
cccaagttcatcaagctgccgttctacctgctggcgcatccgtccatgctgaagcaggac
cgcagtaaaaaggaacggctgatcgcgaacgagttcatccagtgccggaaggtgtgcgag
cacgtgctggagaaggtcctcggggcggacctgcccggaggtgggggcggcagtagcacc
ggtggcgggggcaactccaactcgtcccagaacaacagccaaagcgacgccaactccgag
ggcagccaggtgccggccgaggagcggatcgagctgctgtgcaacgatgtgaataatgaa
gattatggcaaaaatatacacctcaacacttaa

DBGET integrated database retrieval system