KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ014629
Entry
CpipJ_CPIJ014629  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ014629
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ014629
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ014629
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ014629
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ014629
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ014629
SSDB
Motif
Pfam: Tfb5 ODR4-like
Other DBs
NCBI-ProteinID: EDS41261
VectorBase: CPIJ014629
UniProt: B0X6B1
AA seq 58 aa
MKQFLLHLDETQSLGRKFIIQDLDERHLFISTDIIETLQARVDDLMDRISVSLHEKEA
NT seq 177 nt   +upstreamnt  +downstreamnt
atgaaacaattcctgctgcacctggacgaaacacaatcgctcggccgcaagtttatcatt
caggatctggacgaacggcacctgttcatctcgacggacatcatcgagacgctgcaagcc
cgggtggacgacttgatggaccggatcagcgtgtcgctgcacgagaaagaagcctaa

DBGET integrated database retrieval system