KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015824
Entry
CpipJ_CPIJ015824  CDS       T01079                                 
Name
(GenBank) TFIIH basal transcription factor complex subunit 1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ015824
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ015824
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ015824
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ015824
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ015824
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ015824
SSDB
Motif
Pfam: PH_TFIIH BSD FKBP26_C
Other DBs
NCBI-ProteinID: EDS43529
VectorBase: CPIJ015824
UniProt: B0XA64
AA seq 578 aa
MTTTREDVLLQMGEVRFKKGDGTLYVMNERIAWIAEHRDTVAVSHRFQDIKMQKISPEGK
PKIQLQVVLHDGNSSTFHFVNRNGAPAQMADRDKVKELLQQLLPNFKRKIDKELEEKNRV
LTENPSLLQLYKDLVITQVLPSDEFWANHAKQYLSKEIQSQRQDIGVSGAFLADIKPQTD
GCNGLRYNLTSDIIECIFKTYPAVKRKHAEHVPAKLSESEFWTKFFQSHYFHRDRIAAGT
KDIFTECGKIDDQQLKQAVQENLGDPLLDIRGFEDNTLEDGFCSAASSKQTVNSGNIVHQ
SMIKRFNQHSFMVLKTCTDVKTLNRGIGSILNATPGANGTTANGDSNGKDKSKALTNNNN
NVVNGFGKKDKHNNHIANGDATNGNGHPTGPEEPLVEPAIKRARIQEKIHYDDLEDDPDA
SLAPKQLNLTKIERYLHGPVPSTTSSSGGGGGSSFHDPQDAGHDMESVNGYIQQATGSWN
NRTPHKVLVSAKAAVGALGELSPGGALMRGFQEQSLAQLVPPDIEKEIRNLYLSLLELLK
HFWKCFPPTSPQQETQAVRMHEALQRFTMAKLKPFENM
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgaccacgacccgcgaggacgtgctactccagatgggcgaggtgcgcttcaagaagggc
gacggaacgctgtacgtgatgaacgagcggatcgcgtggattgccgagcaccgggacacg
gtcgccgtgagtcaccggttccaggacatcaagatgcagaagatttcgccggagggcaag
ccgaagattcagctgcaggtcgtgctgcacgacgggaacagttcgacgtttcattttgtc
aatcggaatggagctccggcgcagatggcggacagggacaaggtgaaggaactgctgcag
cagctgttgccaaactttaagcgtaagattgataaggagctggaggagaagaatcgggtc
ctgacggagaatccgtcgctgctgcagctttataaggatttggtgatcacccaagtgctg
cccagcgatgagttctgggcgaaccacgcgaagcaatacctgtcgaaggagattcagagc
cagcggcaggacattggcgtttcgggagcgttcctggcggatattaagccgcaaaccgac
gggtgtaacgggttacggtacaatctgacgtcggacattatcgagtgcattttcaagacg
tacccggcggtgaagcggaaacacgccgagcacgttccggcgaagctgtccgagtcggag
ttctggaccaagttctttcagtcgcactacttccaccgggatcggatcgcggccggtacc
aaagacatcttcaccgagtgcgggaagatcgacgatcagcagctgaagcaggcggttcag
gagaatctgggcgatccgctgctcgatatccggggctttgaggacaacacgcttgaggac
gggttctgcagtgcggcgtccagcaagcaaacggtcaacagcgggaacattgtccaccag
agcatgatcaaacggttcaaccagcactcgttcatggtgctgaagacgtgcaccgacgtc
aaaaccctgaacaggggcatcgggtcgatcctgaacgccactcctggtgccaacgggacc
accgcaaacggcgattccaacggcaaggacaaatccaaagccctgaccaacaacaacaac
aacgtcgtcaacgggttcggcaaaaaggacaaacacaacaaccacattgccaacggggac
gccaccaacgggaacggccatcccaccggtccggaagaaccgctcgtcgaacccgccatc
aagcgggcccgcatccaggagaagatccactacgacgatctggaggacgacccggacgcg
agtctggcgccgaaacagctgaatctcaccaagatcgaacggtacctgcacggaccggtg
ccgtcgacgacgtcctccagtggtggcggcggcggaagctcttttcacgacccccaggac
gcggggcacgacatggagtcggtcaacgggtacatccaacaggccaccggctcgtggaac
aaccggacgccgcacaaagtgctagtcagcgcgaaggccgccgtcggtgcgctgggcgag
ctcagtcccggtggggcgctgatgcggggcttccaggagcagagcttagcgcaactcgtt
ccgccggacatcgagaaggagatccgcaacctgtacctctcgctgctggagctgctgaag
cacttttggaagtgcttcccgccgacgagcccccaacaggagacgcaagcggtgcggatg
cacgaggcgctgcagcgcttcacgatggcgaagctgaagccgttcgagaatatgtaa

DBGET integrated database retrieval system