KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016932
Entry
CpipJ_CPIJ016932  CDS       T01079                                 
Name
(GenBank) DNA mismatch repair protein pms1
  KO
K10858  DNA mismatch repair protein PMS2
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03430  Mismatch repair
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    CpipJ_CPIJ016932
   03460 Fanconi anemia pathway
    CpipJ_CPIJ016932
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ016932
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     CpipJ_CPIJ016932
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c FinO_N
Other DBs
NCBI-ProteinID: EDS44415
VectorBase: CPIJ016932
UniProt: B0XBR6
AA seq 860 aa
MIDTEEDMIVPTPTAADSKKITAIDRDTVHRICSGQVVLNLAIAVKELVENSIDAGATVV
EVKLKDYGAELVEVVDNGSGVEQRNFEGMTAKYHTSKLREFSDLAGIETFGFRGEALSSL
CALADMVIVTRHETAPHGTKLELNHRGVITKRSPIARAVGTTVSLSNLFSTLPVRKKEFQ
KNVKKEFFKMSQILQAYCLVSTGVRIICTNQKKKGQKEVVMSTQGTGSVLDNITTVFGTK
QAAELVQLKQAIGTNGKILDLNESDFDENISMTQEEVDSLNLSRYTIEGYISSCAHGSGR
SARDRQFFFVNSRPCEPKQIIKLVNETYHKYNASHTPFVFLNLKMDRADVDVNLTPDKRQ
LLMNNEKILLLALKKSLLKTFGNIPSTFKMQNLNVSETTRLLNISFKSDRGTEDESERED
SFTTSGASLRRLTDAFGRKEVPPVSSKRKRDSPAKLPKIDVFMISTPKQEKASFEDDATL
ERLPKMARNSTMIGEDRDATVKSRSPPSSKVEIFQVAEKVDRPVEIAEPVASSSSTNVLS
ALDVPDEVRVIRCRSKSPNETVLEPLCMKPTETSIEIEESPLEAETSLAVKGQRNLEIDM
SSLKELVDRERKLELQEAARKRVSLSKLKFKCKINPNSNRAAEDELQMEITKEKFGKMEI
IGQFNLGFIIARLDADLFIIDQHATDEKYNFEDLQRNTVLQNQKLVVPQPLELTAVNEMI
LMDSLEIFEMNGFQFEVDGGAEPTKKIKLVAKPFSKNWEFGKEDIDELIFMLQDAVPNTV
CRPSRVRSMFASRACRKSVMIGKALTVAEMRRLVTHMGEIEQPWVRRNKKRLILDLLTIL
LTELSPRTTYDAAPGELDHA
NT seq 2583 nt   +upstreamnt  +downstreamnt
atgatcgacaccgaggaggacatgatcgtgccgacgccaacggccgcggactcgaagaaa
atcacagctattgaccgcgacacggtgcatcggatctgttccggccaagtggtgctgaac
ttggcgatcgccgtaaaagaactggtggagaactcaatcgacgccggtgccaccgtggtc
gaggtgaagctcaaagattacggcgcggaactggtcgaagtggtggacaacggcagtggg
gtagagcagcggaactttgagggcatgaccgcgaagtaccacacgtcgaagctgagggag
ttttccgatctggctgggattgagacgtttgggtttaggggggaagcgctgagctcgctg
tgtgccctggcggacatggtcatcgtaacgagacacgaaacggcgccgcatgggacgaag
ctggagctgaaccatcgcggggtcataacgaagcggagtccaattgcgagggcagttggg
acgacggtgtcgttgagtaatctgttttctacgctgccggtgcggaagaaggagttccag
aagaatgtaaagaaggagtttttcaagatgagtcagattttgcaagcttactgtttggtg
tcaacgggcgttaggatcatctgcacgaaccagaagaagaaaggtcaaaaggaagtggtg
atgagtacgcaggggactggttccgtgttggacaacataacgacagttttcggcaccaaa
caggctgccgaactggtccaactgaagcaagctattggcacgaatggaaagattctggat
ttgaatgaaagtgactttgacgagaatatctcgatgacacaggaggaagtggacagtcta
aacttgtccaggtatacaatcgaaggttacatttccagctgcgcccacggttccggacgc
tccgcgcgagatcgccaatttttcttcgtaaactcgcgaccctgcgaacccaaacagatc
atcaagctggtcaacgaaacctaccacaagtacaacgcaagccacactccgttcgtgttc
ctgaacctgaaaatggaccgcgccgacgtcgacgtcaacctgaccccggacaagcgccaa
ctgctgatgaacaacgaaaaaatcctgctactcgcgctcaaaaagtccctgctcaaaacg
ttcggcaacattccgtccaccttcaagatgcagaatctcaacgtgagcgaaaccacgcgg
ctgctcaacatttcgttcaagtcggatcgcggcaccgaggatgagagtgagcgggaggat
agcttcacgacgagtggggcgtccctgcggcgactgacggacgcgtttggacggaaggaa
gtgccgccggtgagcagcaagcggaagcgggacagtccggccaagctgccgaagattgac
gtgttcatgatctctacgccgaagcaagagaaagcaagctttgaggatgatgcgacactg
gaaaggctaccgaaaatggcgcgcaattcgaccatgatcggtgaggatcgcgatgcaact
gtgaagagtagatctcctccttcgagcaaagtcgagatctttcaagttgcggagaaagtg
gatcgaccagtagaaattgcggaaccggtggcgagtagttcgagtacgaatgttctttca
gcgctcgacgtacccgacgaggtccgggtcatccgttgtcgcagtaaaagtccaaacgaa
acggtgctggagccactctgcatgaagccgacggaaacttcaatcgagattgaggaatcc
ccgctggaagcggaaacgtccctcgcggtgaaagggcagcgcaaccttgaaatcgacatg
tcctcgctgaaggagctggttgatcgtgagcgaaaactggagctacaggaggccgcccgg
aagcgggtttcgttgagcaagctaaagttcaagtgtaagattaatccgaacagcaatcgc
gctgccgaggacgagctgcagatggagatcacgaaggaaaagtttgggaagatggagatc
attggtcagttcaatttgggctttataattgcgaggttggacgcggatttgttcatcatc
gatcagcacgcgacagacgaaaagtacaactttgaagatctgcagcgaaatacggtgctg
cagaaccagaagctggtcgtgccgcagccgctcgagttgaccgccgtaaacgagatgatc
ctgatggacagcctggaaattttcgaaatgaacggctttcagtttgaggtcgatggcggc
gcggaaccgacgaagaagatcaaactggtggcgaaaccgttcagcaaaaattgggagttt
ggaaaggaggacatcgacgagctgatctttatgctacaggatgccgtcccgaacacggtg
tgtcgaccgtcgcgagtgcgctcaatgtttgcctcgcgagcctgccggaagtccgtgatg
attggcaaggcgctgacggtcgcagaaatgcgccggctggtcacgcacatgggcgagatc
gagcaaccttgggtaagaaggaacaaaaaacgcctcattttagatcttctaacaattttg
cttacagaactgtccccacggacgacctacgatgcggcacctggtgaacttgaccatgct
tga

DBGET integrated database retrieval system