KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018238
Entry
CpipJ_CPIJ018238  CDS       T01079                                 
Name
(GenBank) DNA polymerase IV
  KO
K03510  DNA polymerase iota [EC:2.7.7.7]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ018238
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ018238
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CpipJ_CPIJ018238
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    CpipJ_CPIJ018238
SSDB
Motif
Pfam: IMS IMS_C UBM HHH_5 DUF4332 Cdd1 IMS_HHH TfoX_C DNA_pol_lambd_f
Other DBs
NCBI-ProteinID: EDS26826
VectorBase: CPIJ018238
UniProt: B0XFI8
AA seq 647 aa
MDDEELVAAQDHPQHQQQHPRVIIHIDMDYYYAQVEEVLDPSLKDKPVGIKQRFHVVTSN
YVAREFGIKKMTLITEARKLCPELVLVDGEDISKYKQMSARINEIMHKFSGNVEKLGLDE
NYLDVTKEISEQLEQGVEAGLLDRVEGYVYPPLEGGCSEREAFRRACGCGCDRRLILGTH
MAKEIRDCIARELGLKCCAGVAHNKLLAKLVGSVNKQNKQTVLLPNCGSSFLASLGSVKA
LTGIGEKTAEILEEVGVKTVRDLQETSVEKLAKRLGLEQAGRLKEIAFGKDDTPVKATGK
PKSVGLEDSCPAISIRADAEDKFRHLIVRLVKNIAEDGRIPIAIKVTIRKHDSVRRTSHR
ECKQDKIMPSFFRHKDGKLVLADGAQDKILAIVMKLFERMVDLQQPFNITLLGLSFFKFQ
ERRMGTKSIANFLIKKSDIEVQSITNLSNESITLSDSFTSNKSSLSMSTAMDCDSASLAS
LSGSESDAEPSPKKCRRLATFLARKSGLLSANEDDSSSPSKLRVADLRLNSKEYDQEPCS
SSHNNPADIPSTSKSPSFFKNHLSSSTPAKVSPLTLEPTSTATNLPSNVDPEVFNALPPD
VQQELLQNWRIAATPTSSSSNAAAAATTAASSSSKSNTLHRYFVKNT
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggacgacgaagagctcgtcgcggcacaagaccatccgcagcatcagcagcagcacccg
cgcgtgatcatccacatcgacatggactattactacgcccaggtcgaggaggtactggat
ccgtccttgaaggacaaaccggtcggcatcaagcagcgcttccacgtggtcacgtcgaac
tacgtggcgcgcgagtttggcatcaagaagatgacgctgattacggaggcgcgcaagttg
tgtccggagctggtgctggtcgacggagaggacatcagcaagtacaagcagatgtcggca
cggatcaacgagattatgcacaagtttagcgggaatgtggagaagctggggctggacgag
aactatttggatgtaacgaaggagattagcgagcagctggagcagggtgtggaggcgggg
ttgttggaccgggttgagggttacgtgtatccgccgttggaggggggttgttccgagagg
gaggcgtttcggagggcttgcggttgtggctgtgatcggcggttgattttgggcacgcac
atggcgaaggagattcgagactgcattgcgagggagctggggttgaagtgttgcgcgggg
gttgcgcacaataagctgctggcgaagttggtcgggagtgtgaacaagcagaacaaacag
acggtgctgctgccgaattgtgggtcgagttttttggcatcgctggggtcggtaaaggcg
ctgacggggattggggagaagacggcggagattttggaggaggttggtgtgaagacggtg
cgggatctgcaggagacgtcggtggagaagctagcgaagcggttgggactggagcaggct
ggtcggttgaaggaaattgcctttggaaaggacgatacgccggttaaggcgacggggaag
ccaaagtccgttggtttggaagattcctgcccggcgatctcgatccgggcggacgccgag
gacaagttccgacacttgatagtgcgactggtgaagaacatcgccgaagacggtcggatt
ccgatcgcgatcaaggtcaccatccggaagcatgactccgtccgaagaacgagccaccgc
gagtgcaaacaggacaaaatcatgccgtcgttctttcgccacaaggacggcaaactggtg
ctggccgacggagcccaggacaaaatcctcgccatcgtgatgaagctgttcgagcggatg
gtcgacctgcagcagcccttcaacatcactctactcgggctgtccttcttcaagttccaa
gagcgccgaatgggcaccaaatccatcgccaacttcctcatcaaaaagtccgacatcgag
gtgcagtccatcaccaacctgagcaacgaatccatcaccctcagcgacagcttcacctcc
aacaaatcgtctctctcgatgtccaccgcgatggactgcgactctgcctcgctcgcgtcc
ctctccggttccgagtcggacgcggagccgtccccgaaaaagtgccgccgcctggccacc
ttcctcgcgcgcaaaagtggcctcctctcggccaacgaagacgattcgtcctcgccgagc
aaactgcgcgtcgcagacctgcggctcaactcgaaagagtacgaccaggaaccctgcagc
agcagccacaacaaccccgcagacattccatccacctccaaatcgcccagcttcttcaag
aaccacctctcgtcgtccacgccggccaaagtgtcgccgctgacgttggagccgacgtcc
accgccaccaatctgccttcaaacgttgacccagaagtgtttaacgcgctgccgccggac
gtccagcaggagctgctgcaaaactggcgaatagcagcgacgccaacgagtagcagtagc
aacgccgcggcagcggcaacaacagccgcaagcagcagttcgaaaagcaacacactccat
cggtactttgttaagaatacttag

DBGET integrated database retrieval system