KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018296
Entry
CpipJ_CPIJ018296  CDS       T01079                                 
Name
(GenBank) cak1
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ018296
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ018296
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cqu01001]
    CpipJ_CPIJ018296
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ018296
   03019 Messenger RNA biogenesis [BR:cqu03019]
    CpipJ_CPIJ018296
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ018296
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     CpipJ_CPIJ018296
    2.7.11.23  [RNA-polymerase]-subunit kinase
     CpipJ_CPIJ018296
Protein kinases [BR:cqu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   CpipJ_CPIJ018296
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ018296
Messenger RNA biogenesis [BR:cqu03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     CpipJ_CPIJ018296
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ018296
SSDB
Motif
Pfam: Pkinase
Other DBs
NCBI-ProteinID: EDS27363
VectorBase: CPIJ018296
UniProt: B0XGB0
AA seq 196 aa
MLRSERFWSALIVSTKACVVTRWYRSPELLFGARQYGVGVDIWAVGCILAELLLRVPFLP
GESDLDQLTRIFQVMGTPNEENWPDVKSLPDYVQYKQFPPIPLRDIFTAAGDDLLDLIYK
LLALYPLNRCSCTDALKMPYFSNKPAPTVGDKLPMPASYHAGVNKDAASKEDKGPTLKRK
LPDSVDGGTLPKRLQF
NT seq 591 nt   +upstreamnt  +downstreamnt
atgttgcgctctgaacgattttggagcgcgctgatcgtttcgacgaaagcgtgtgtggtg
acccggtggtatcggtccccggagttgctgtttggtgcccggcagtacggtgttggcgtg
gatatttgggccgtcggatgtattttggcggagttgcttcttcgggtgccgttcctgccg
ggggaaagtgatctggaccagctgacgcgcatctttcaggtgatgggcacgccaaatgag
gaaaactggcctgacgttaagtctctgccggactacgtccagtacaagcagtttccgccg
attccgctgcgggacattttcaccgcggccggtgacgacctgctggacctcatctacaag
ctgctggcgctgtacccgttgaatcggtgttcctgtacggatgcgctcaagatgccgtac
ttttccaacaagccggcaccgaccgtcggcgataagctgccgatgccggccagctaccac
gccggagtcaacaaggacgccgccagcaaggaggacaaagggccgacgctgaagcgcaag
ctgccggacagcgtggacggcgggacgctgccgaagcggttgcagttttga

DBGET integrated database retrieval system