KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018703
Entry
CpipJ_CPIJ018703  CDS       T01079                                 
Name
(GenBank) TFIIH basal transcription factor complex helicase subunit
  KO
K10844  DNA excision repair protein ERCC-2 [EC:5.6.2.3]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03022  Basal transcription factors
cqu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    CpipJ_CPIJ018703
  09124 Replication and repair
   03420 Nucleotide excision repair
    CpipJ_CPIJ018703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cqu03021]
    CpipJ_CPIJ018703
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ018703
Enzymes [BR:cqu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     CpipJ_CPIJ018703
Transcription machinery [BR:cqu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CpipJ_CPIJ018703
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CpipJ_CPIJ018703
SSDB
Motif
Pfam: DEAD_2 HBB ResIII SNF2-rel_dom DEAD DCA16 AAA_11 AAA_19
Other DBs
NCBI-ProteinID: EDS28354
VectorBase: CPIJ018703
UniProt: B0XHE1
AA seq 542 aa
MFEEIVRCMKSGIAPGIDRISAEMLKAITPSCQLGCCIGYLAKSGTTISVDGLLVYFPYE
YIYPEQYAYMLELKRTFDAKGHCLLEMPSGTGKTTTLLSLIVAYIMENPHIVRKLIYCSR
TVPEIEKVIAELKHLMNYYEKQTGVMPNITGLVLSSRKNMCIHSEVSKERDGKIVDAKCY
GMTASYVRDRAATDDSVPICQYFEGFQAEGKETTLPPGVYSIDDMKEFGRERNWCPYFMS
RFAINQAHVVVYSYHYLLDPKIAEVVSKELARESVVVCDEAHNIDNVCVDSMSVKINRRL
IEKSTTGVHTLEKYVAEMKDDDRRRLNDEYLRLVQGLKDAAMQRETDMVLANPALPSEIL
KEVVPGNIRNADHFLSFLKRFIEYIKSRLRVQHVVQESPAGFLKDIQQKVCIERKPLRFC
AERLSSLLRTLEITDLTEFGPLTVITSFATLVSSYTKGFTIIIEPFDDKTPTVSNPIMHL
SCMDSSIAMKPIFQRFQSVVITSGTLSPMDMYPKILDFEPVVMSSFTMTLARPCLLPMIL
VI
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgtttgaggaaatcgtgaggtgtatgaagtccggaatagcgccagggatagatcggatc
tccgcagaaatgctcaaagctataacgcccagctgtcagctcggatgctgcatcggctat
ttagcaaaatctgggacaacgataagcgtcgacggtctgctggtgtacttcccgtacgag
tacatctacccggagcagtatgcgtacatgctcgaacttaagcgcaccttcgacgccaag
ggccactgcctgctggagatgccctcggggacgggcaaaaccacgacgctgctttcgctg
atcgtggcgtacatcatggagaacccgcacatcgtacgcaagctgatctactgctcgcgt
accgtgcccgaaatcgaaaaggtcatcgccgagttgaaacatctgatgaactactacgaa
aagcaaaccggcgtgatgcccaacatcaccgggttggtgctgtcctctcgtaagaacatg
tgcatccactcggaggtcagcaaggagcgcgacggcaagatcgtggacgcaaagtgctac
ggcatgacggcgagttacgtgcgagatcgggccgcaaccgacgactccgtgcccatctgt
cagtactttgagggcttccaggcggagggcaaggaaacgacgctcccacccggggtctac
tcgatcgacgacatgaaagagtttggccgcgagcgcaactggtgtccgtactttatgtcg
cgcttcgcgatcaatcaggcacacgtggtagtgtacagctaccactacctgctggatccg
aagattgccgaggtggtctcgaaggagctggcccgcgagtcagtcgtggtttgcgacgag
gcgcacaacattgacaacgtctgcgtggactcaatgagcgtcaagatcaaccgtcgattg
atcgagaaaagtacgactggagtgcacacgctggagaaatacgtcgcagaaatgaaggac
gacgaccggcgacggctcaacgacgagtacctccggctggtacagggtctcaaggacgct
gcgatgcagcgcgagacggacatggtcctcgccaacccggctctcccgtcggaaatcctc
aaggaggtcgtccccgggaacatccgcaacgccgatcacttcctcagctttctgaagcgc
ttcatcgagtacatcaagtcgcgcctacgcgtgcagcacgtcgttcaagagagtccggcc
ggctttctgaaggacatccagcagaaggtttgcatcgagcggaaaccgctaaggttttgt
gcggaacgactgtcgtcgctgctgcgcacgctggagattacggacctaaccgagttcggt
ccgctaacggtgattacgtcgttcgctacgctggtgtcgagctacacgaaagggtttacg
attattatcgaaccgtttgacgataaaacgccgacggtgtcgaacccgatcatgcacctg
agctgcatggactcgtcgatcgcgatgaagccgatctttcagcgcttccagagcgttgtg
attacgtcgggaacgctctcgccgatggacatgtacccgaagatcttggactttgagccg
gtggtgatgagttcgttcacgatgacgctggccaggccgtgtctgctgccgatgatactg
gttatttaa

DBGET integrated database retrieval system