KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ020191
Entry
CpipJ_CPIJ020191  CDS       T01079                                 
Name
(GenBank) conserved hypothetical protein
  KO
K10896  fanconi anemia group M protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    CpipJ_CPIJ020191
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cqu03400]
    CpipJ_CPIJ020191
DNA repair and recombination proteins [BR:cqu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     CpipJ_CPIJ020191
SSDB
Motif
Pfam: SecA_DEAD
Other DBs
NCBI-ProteinID: EDS35434
VectorBase: CPIJ020191
UniProt: B0XLX6
AA seq 703 aa
MILFRDWSVQFKQTELPQILARVAAVWAIAVSTDVSSTGKFFKPHCVQILCVLKLLGVDA
GTTGVPKHLAQVLTGQGKSLILALIAAVLALTGHYVQIACYNEYLVKRDGGEFEEFYKLL
GVSDVVKYGTFEDMANAVVAPEVDGKRMELRTFVQDMILSYGGGSRPKKPKPQVRANSVL
LMDEVDVFFTKEYYVTFRIRRRNNRWTSSHQRRNSQFRLSNIHAGFDPHSGQSWLFPVDF
VTPDYLPLIVEKTLYHNSLVILPNRFEVSFVAAVVMHNVYRWYPFGKVVFICSNRKATQD
QRAACDRLMKFVPSDVVDMALKPHERVRNWATKRAFFITSHTMAGEMARQEAERVGMRKI
KLVVIEDPQLDVRAHSAIIQKLTEMGANFRVLCVTTTHGKTVEPAQLKQWHISNIELQWG
NPQEKPDEWLMNKKEISNIVTVLGAVMDGLLAELQLLTQRYLANLHACKQIANTSLFETI
TADHIRQERTRYELSVLTGVVRKNHYEVMRNFHMAEKLVLAHRILARDGVVALMDYFHLQ
NDALGQADSELSAFCTCVNCSGSHEGLTAAVPNVRSSSSRGSRRHAKPPAWKKDKQTPAG
ATFTAADFPPLPSVGTEEKHPRPAGRSPDNTGAGAGATPKEDQGEPKLYSELELWSIYRE
YRVRLRQCKTPEEQIDVIAHLLTHGTRKWSSKTIILALIQSVN
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgatcctgttccgcgactggtccgtgcagttcaagcagaccgagctgccccagatcctg
gcccgagtggcggccgtatgggcgatcgcggtctccaccgacgtgtccagcaccggcaag
ttcttcaagccgcactgcgtccagatcctgtgcgtgctgaagctgctcggcgtggacgca
gggacgacgggagttccgaaacacctggcgcaggttctcaccggccagggaaagtcgctg
attctggcgttgatcgcggcggtccttgcgctgactgggcattacgttcagatcgcttgc
tataatgaatatttggtgaagcgggacgggggcgagtttgaggagttttacaagctgctg
ggtgtgagcgatgttgtaaagtacggaacgttcgaagatatggccaacgcggtcgtagcg
cctgaggttgatgggaagcggatggagcttcgaaccttcgttcaagatatgatcctgtcg
tacggcggaggttcacgaccgaagaagcccaagccacaggttcgcgccaactcggttctg
ctgatggacgaagtggacgtgttcttcaccaaagagtactacgtaacgtttcgaatccgt
cgccggaacaatcgctggacaagcagccaccagcgccgcaacagccagttccgcctttcc
aacattcacgccggcttcgatccgcactcgggccagagctggctgtttccggtggacttt
gtgacaccggactatctgccgctgatcgtggagaagacgctgtaccacaactcgctggtg
atcctgccgaaccggttcgaggtttcgttcgtggcggcggtcgtgatgcacaacgtttac
cgctggtacccgttcgggaaggttgtgtttatctgttcgaaccggaaggccacccaggac
cagcgggcggcctgcgatcggctgatgaagtttgtgccgtcggatgtggtggacatggcg
ctgaagccgcatgaacgggtgaggaattgggcgacgaagagggcgttctttataacgtcg
cacacgatggccggggagatggcccgccaggaggcggaacgggttggaatgcggaagatt
aagctggtggtgatagaggacccgcagctggacgtgcgagcgcactcggcgattattcag
aagctgacggagatgggggctaacttccgggtgctttgcgtgacgactactcatgggaaa
acggtcgagccggctcagcttaagcagtggcacatttcgaacattgaactgcagtggggc
aatccgcaggagaagcctgacgagtggctgatgaacaagaaggagatcagcaacattgtg
acggtgctcggggcggtgatggacggtttgctggcggaactgcagctgctgacccagcgg
tacctggccaacctgcacgcctgcaagcagatcgccaacacgagcctcttcgagaccatc
acggcggaccacatccggcaggaacgaacgcgctacgagctgtccgtgctgaccggggtg
gtgcggaagaaccactacgaagtcatgcgcaacttccacatggccgagaagctggtgctg
gcccaccggatcctggcccgggacggtgtcgttgcgctgatggactactttcacctgcag
aacgatgcgctgggtcaggcggacagcgagctgtcggcgttctgcacatgtgtcaactgc
tctggatcccacgagggtctgaccgcagctgtcccaaacgtgcgcagttcatccagtcga
ggcagcaggcgtcacgcgaagccgccagcatggaagaaggacaagcagactccggcagga
gccacgttcaccgcggcggattttcctccgctgccgtccgttgggacggaagaaaagcat
cctcgtcccgcaggaagaagtccagataatactggcgccggcgccggtgcaaccccgaag
gaggatcaaggcgaaccgaagctgtacagcgagttggagctgtggtccatttaccgagag
tacagagttcgcttgaggcagtgcaagacccccgaggaacagatcgatgtgatcgcacac
ttgctgacacatgggacgagaaaatggtcatctaagacgatcatccttgccctgatacaa
agtgtaaactaa

DBGET integrated database retrieval system