KEGG   Capsella rubella: 17875606
Entry
17875606          CDS       T02984                                 

Name
(RefSeq) agmatine coumaroyltransferase
  KO
K14329  agmatine coumaroyltransferase [EC:2.3.1.64 2.3.1.-]
Organism
crb  Capsella rubella
Pathway
crb00330  Arginine and proline metabolism
crb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    17875606
Enzymes [BR:crb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.64  agmatine N4-coumaroyltransferase
     17875606
    2.3.1.-  
     17875606
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 17875606
NCBI-ProteinID: XP_006280457
UniProt: R0GM03
Position
Unknown
AA seq 449 aa
MALNVIKISRVSPATATVEPLIVPLSFFDLQWLKLNPTEQVFFYKLTESSSRDSFYSSIL
PKIERSLSLVLSHFLPFTGHLKWGSQNPKPHLVVLPGDIVSLTIAEMDADFTRISGKGLR
PELELRPLIPKLPIHSDSAAVVSLQVTFFPDQGYCIGTTIHHVVVDGKTAEKFNNAWAHT
CKHGTVPKNLPTVLDRSVVNVPAGFERKLLELLPYLTEDKENARTLMLPPVKEINAKDNV
LRTTIEVTPKNIEKLKERAKKESSRAELHLSTFVVTFAHVWTCMVKARGGDADRPVRFMY
AADFRDRLDPPVPATYLGPCVLAMDFYKYKAKKFLGDDGYVNTVEILSDSVKRLRSQGVE
STWKCYEEGTKTMELGTQLMVVNGSNQIGMYDTDFGWGRPVHTETMSLYKNDEFSMSKRR
DGIGGVEIGVSLKQCEMDVFLSLFTNALI
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggcgttaaacgtgatcaagatctcccgagtcagtccagcaacagccaccgtcgaaccg
ctcatcgtcccactctctttcttcgatttacaatggcttaaactaaaccctacggagcaa
gtctttttttacaaactcaccgaatcatcatctcgcgactctttctactcctccatcctc
cccaagatcgagcgatctctttcactcgtcctctctcactttctcccatttacgggtcac
ctcaaatggggctctcaaaaccctaagccgcatcttgttgttctcccgggagacattgta
tctctcacaatagctgagatggatgcggatttcacgcgtatctctggcaaaggacttcga
cctgagctagagttacgccctctgatacctaaactaccaattcattccgactctgccgcg
gttgtttctctacaagtcacattttttccagaccaaggctactgcatcggaaccactatc
caccacgtcgtcgtggacggcaaaacggctgagaagtttaacaatgcatgggctcacact
tgtaaacacggaaccgtacccaaaaatttaccaacggttttagatcgttctgtcgtcaat
gttccagccggattcgaacggaagctcttggaacttctgccgtatctcacggaagacaaa
gagaacgcaagaaccctgatgctccctccagtcaaagaaataaatgctaaagacaacgtc
ctccgaaccacaatcgaggtgactcctaaaaacattgagaaactcaaggagcgagccaag
aaagagtcatctcgggcagagcttcacttgtcaacattcgtagtcacgttcgcccacgtg
tggacatgcatggtgaaggcccgtggaggcgatgcagatcgaccggttcgtttcatgtac
gctgctgatttcagagaccggctagacccaccagttcctgcgacctaccttgggccttgt
gtcttagccatggatttctataaatacaaagcgaagaagtttttaggggacgatggatat
gtcaataccgtcgaaattctgagtgactcggtcaaaaggttacgttcacaaggggtggag
tcaacttggaagtgttatgaagaaggaacaaagacgatggaattgggtacgcagctgatg
gtcgtaaacgggtcgaaccagattgggatgtacgacacggatttcgggtgggggagaccg
gtacacaccgagactatgtctctctacaagaatgatgagttctctatgtccaagagaaga
gatgggatcggtggcgtcgagattggcgtctctttgaagcaatgtgagatggatgttttt
ttgtctctgtttacaaatgcactcatctag

DBGET integrated database retrieval system