KEGG   Capsella rubella: 17884309
Entry
17884309          CDS       T02984                                 

Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic isoform X1
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
crb  Capsella rubella
Pathway
crb00290  Valine, leucine and isoleucine biosynthesis
crb00966  Glucosinolate biosynthesis
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    17884309
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    17884309
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     17884309
    1.1.1.-  
     17884309
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 17884309
NCBI-ProteinID: XP_006286429
UniProt: R0FBA1
Position
Unknown
AA seq 408 aa
MAAFLQTNIRMSSIKIVPGKYSALTDHYRTPCRVRCAASSPGKKRFNIALLPGDGIGPEV
IAVAKTVLQKAGSLEGLEFDFQEMPVGGAALDLVGVPMPEETFTAAKQSDAILLGAIGGY
KWDKNEKHLRPEMALFYLRRDLKVFANLRPATVLPELVDASTLKKEVAEGVDMMIVRELT
GGIYFGEPRGIKINENGEEVGISTEIYAAHEIDRIARVAFETARKRRGKLCSVDKANVLD
ASILWRKRVTALASEYPDVELSHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMI
TGSIGMLPSASLSESGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAK
RIEDAVADALSKGFRTGDIYSPGNKLVGCKEMGEEVLKSVDSKVPATV
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcggcgtttttgcagacgaacatccgaatgagttcgatcaagatcgtcccgggaaaa
tacagtgctctcaccgaccattatcgcacgccgtgtcgtgtaaggtgtgccgcctcttca
ccggggaaaaaacgttttaacatcgctctacttcccggcgacggaattggtccagaagtt
atcgctgttgctaagactgtgcttcagaaagctggatctcttgaaggactggagtttgat
ttccaggagatgcctgtcggaggagcagccttggatttggtcggagttcccatgccggag
gaaactttcaccgctgctaaacagtctgatgctatacttcttggagctattggagggtac
aaatgggacaagaatgagaaacatctgagacctgagatggctctgttttatcttcgaaga
gatctcaaagtctttgcaaatctaagacctgctaccgttttgccagagttagttgatgca
tccacgttgaagaaagaagtagcagaaggtgttgatatgatgattgtaagagagctcact
ggaggtatttactttggagagccaagaggcattaagatcaatgaaaatggcgaagaagtt
ggcattagtacagagatctacgctgctcacgagattgacagaattgctcgtgttgcattc
gagactgctaggaaaaggcgtggcaagttgtgttctgtggacaaagccaatgtgttggat
gcatcaatattatggaggaaaagagtaacagcgttagcctctgaatatccagatgttgaa
ctatcacatatgtatgttgataatgctgcaatgcagcttatccgtgaccccaaacagttt
gacacaatcgtcaccaataacatttttggtgatatattatctgatgaagcttcaatgatc
actggaagcattggaatgcttccatctgcgagtctcagtgaatcgggacctggactcttt
gaacctatacacggttctgcaccagatatagctggacaagacaaggcaaacccattggcc
actattctcagcgccgctatgcttctgaaatatggacttggagaagaaaaagctgcaaag
aggattgaagacgctgtcgcggatgctctgagcaaagggttcagaactggagacatctac
tcccccggaaataaactggtgggatgcaaagaaatgggagaagaggtgctcaaatcagtg
gactccaaagttccagctactgtttaa

DBGET integrated database retrieval system