KEGG   Capsella rubella: 17889158
Entry
17889158          CDS       T02984                                 

Name
(RefSeq) tricyclene synthase, chloroplastic isoform X1
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
crb  Capsella rubella
Pathway
crb00902  Monoterpenoid biosynthesis
crb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    17889158
Enzymes [BR:crb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     17889158
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 17889158
NCBI-ProteinID: XP_006293874
UniProt: R0FV26
Position
Unknown
AA seq 593 aa
MTTVLHIGSAFIYSNARAKTLPRPKPACTTVATMTSHNDNSTTVPRRSANYQPSLWDHHH
LLSLENQYAKDKSMRERDLLKEKVRKMFDDEKKTYLEKLEFIDDVERLGISYHFQAEIDN
ILLSSYQKDRVNVKECDLHATALEFRLFRQHGFNVSEDIFDVFMANSEKFESGTDINAFI
SLYEASYLSTKLDSKLQKFIRPFAKQKLRDFLDNNGSSNRDFGSCNAGEMVVQALDMPYH
WGMRRLATRRYINVYGKKHNKNLLLVELAKTDFNIVQAVHQEEVKYVSRWWRETGLGTQL
HFARDRIVENYFWTIGQIQEPQYGNVRRVVTKINTLLTSIDDIYDIYGTLEELQLFTVAF
ENWDVNRLDELPEYMRLCFLVVYNEVNSIGCDVLRKKNINVIPFLKKSWTDVCKAYLIEA
MWYKRGHKPNLEEYMQNAWISISSPTIFIHFYCVFSDQISLQVLETLSQHQQNVVRCSSS
VFRLANDLATSPDELARGDVHKSIQCYMNETGASEEKARSHVREMINDMWDEMNYEKMAH
NTSLLSHDFMETMINLARMSLCMYQYGDGHGSPEKAKIVDRVKSLLFNPIPLD
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgaccactgtactacatataggttcagcttttatttacagtaatgcccgtgcaaagact
cttccacgtcctaagcctgcatgcaccacagtggccacaatgacatcacataatgataac
tcaaccacagttcctcgccgttccgcaaactatcaaccttctctttgggaccatcaccat
ctcctctcactggaaaatcaatatgcgaaagataaaagcatgcgagagagagatttgttg
aaggaaaaagtgagaaagatgttcgatgatgagaagaagacttatctcgaaaaattagag
ttcatcgacgatgtagaaagactcggtatttcataccattttcaagcggaaatcgataac
attctactatcttcttatcagaaagatagagtaaacgtcaaggaatgtgacctacatgcc
accgcactcgaattccgacttttcagacaacatggtttcaatgtttcagaagatatattc
gacgttttcatggcgaatagtgagaagtttgagagtggtactgatataaatgctttcata
tctctatatgaagcgtcgtatctttcgacaaaactggattctaaactgcaaaaatttatc
agaccttttgcaaaacaaaaactcagagactttcttgataataatggtagtagtaataga
gatttcgggtcctgtaacgccggggagatggtggtccaagcgttagatatgccctaccat
tggggtatgagaaggctagccacgagacggtacataaatgtttatggaaagaaacataac
aagaaccttctcctagttgagttggccaagactgatttcaacatcgtacaagctgttcat
caagaagaagtcaaatacgtttccagatggtggagggagacaggtttaggtactcaactt
cactttgcaagagacagaatagtggaaaactatttttggacgataggacaaatccaagag
cctcaatacggaaacgttcgacgagtagtgactaaaataaatacacttcttactagtatt
gatgatatctacgatatctatggcactcttgaagaacttcaacttttcactgtcgcgttt
gaaaattgggatgtaaatcgtcttgatgaactccctgagtacatgaggttgtgttttctt
gttgtgtacaatgaagtcaatagcatcggatgtgatgtcctcagaaagaaaaatatcaac
gtgattcctttcctcaaaaaatcttggacagatgtatgcaaagcatatttaatagaagcg
atgtggtacaaaagaggccacaaaccaaatctggaagagtacatgcaaaatgcttggatt
tcgatatcgtccccaacgatatttattcacttctactgcgtgttttccgaccaaatctct
cttcaagtcttggaaactttgtcccaacaccaacaaaatgtcgtccgatgctcttcctca
gtgttccgtctagccaacgaccttgcaacctcaccggatgaattggcgagaggagacgtc
cacaaatccatccagtgttacatgaatgagacaggagcttcagaggagaaggcgagatcg
cacgtgcgagagatgatcaatgacatgtgggatgaaatgaattacgaaaaaatggcacat
aacacctcgctactcagtcatgattttatggaaactatgatcaatttggcacgcatgtcg
ctgtgcatgtatcaatatggagatggccatggctctcccgaaaaagccaaaattgttgat
cgtgtcaagtccttactcttcaatcctattcctttagattaa

DBGET integrated database retrieval system