KEGG   Capsella rubella: 17889311
Entry
17889311          CDS       T02984                                 

Name
(RefSeq) tricyclene synthase, chloroplastic
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
crb  Capsella rubella
Pathway
crb00902  Monoterpenoid biosynthesis
crb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    17889311
Enzymes [BR:crb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     17889311
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 17889311
NCBI-ProteinID: XP_006293887
UniProt: R0HNF5
Position
Unknown
AA seq 589 aa
MATLLQIGSFLIYNNALAKTTLQRPQSFKWTTMAKMTPGESPTVLRRSANYQPSRWDHSD
LLSIKNKYAKAKRVEERDLLKEKVRKMLGDEKKTYIEQLELIDDLQKLGVSYHFEREIEN
ILTVSYQKDRINIRKDLRATALEFRLFRQHGFNVSEGVFDVFMENCGEFESDDIGGLISL
YEASYLSTKWDTKLQQFIRPFATQKLRDIVDTQCDKDFGSCDIVDMVVQALDMPYYRRMR
RLATRWYIDVYGKRRNKNLVVVEFAKIDFNIVQAIHQEELKYVSSWWRETGLGNQLHFAR
DRIVENYFWTIGHIHEPEFGYVRRTMTKVNALITTIDDIYDIYGTLEELQLFTDAVESWD
LNRLDELPDYMRLCFRVMYNEVNSIGRDVLRKKNINVIPFLKKSWTNLCKSYLVEAKWYK
RGHKPKLEEYMNNAWISVSIPTIYVHFYCVFSDQLSIQVLETLSQHQQNIVRCSAYVVRL
ANDLATSQDELARGDVHKSIQCYMNETGASEEKARSHVRQMINDLWDEMNYEKMSHGSSL
HHHDFMETVMNLARMSLCMYQYGDGHGSPEKAKIVDRVMSLLFNPVPLD
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggccactttactgcagataggttcatttctcatttacaataatgcacttgctaagacg
actcttcaacgtcctcagtctttcaagtggaccacaatggccaaaatgacaccgggtgag
tctcccactgttcttcgtcgttcggcaaactatcagccttctcgttgggaccacagcgat
ctcctctcgatcaagaataaatatgcgaaagctaagagagtggaagagagagatttgctg
aaggaaaaggtgagaaagatgctaggtgatgagaagaagacatacatcgaacaattggag
ctgatcgacgatcttcagaaactcggggtttcttaccattttgaacgggaaattgaaaac
attttaacagtttcttatcaaaaagatagaattaacataagaaaagatttgcgtgccacc
gcactcgaattccgactttttagacaacatggtttcaatgtttcagaaggtgtattcgat
gttttcatggaaaattgtggggagtttgagagtgatgatataggtggtctcatatctctt
tacgaagcgtcatatctttccacaaaatgggatacgaaactacaacaattcatcagacct
tttgcaacacaaaaactaagagacattgttgacactcagtgtgataaagattttgggtca
tgtgacatagtggacatggtggtccaagcgttagatatgccctactataggcgaatgaga
aggctagccacaagatggtacatagatgtttatggaaagagacgtaacaagaatcttgtc
gtagttgaattcgccaagatcgatttcaacattgtacaggctattcatcaagaagaactc
aaatacgtttccagctggtggagggagacaggtttaggtaatcaacttcactttgcaaga
gatagaatcgtggagaattatttttggactattggacatatccacgaacctgagtttggt
tacgttcgtcgaacaatgactaaagtaaatgcacttattacaactatcgatgacatctac
gatatctatggtactcttgaagaacttcaacttttcactgacgcggttgaaagttgggat
ttaaatcgccttgatgaactccctgactacatgaggttgtgttttcgtgttatgtacaat
gaagtcaatagcattggacgtgatgtccttagaaagaaaaatatcaacgtgattcctttc
ctcaaaaaatcttggacaaatctatgcaaatcatatttggtagaagcaaaatggtacaaa
agagggcacaaaccaaaactggaagagtacatgaataatgcttggatttcagtatcgatc
ccaacgatatatgtccacttctactgcgtattctccgaccaactctctattcaggtcttg
gagactttgtcccaacatcagcaaaacattgtccgatgctctgcctatgtggttcgtcta
gccaacgatcttgcaacctcacaagatgaattggcgagaggagacgtccataaatccata
caatgttacatgaatgagaccggagcttcagaggagaaggcgagatcgcacgtgcggcag
atgatcaacgacttgtgggatgaaatgaattacgagaaaatgtcacatggctcttcgtta
caccatcatgattttatggaaactgtaatgaacttggcacgcatgtctctgtgcatgtat
caatatggcgatggccatggctctcctgaaaaagccaaaattgttgatcgtgtcatgtcc
ttactcttcaatcccgttcctttagattga

DBGET integrated database retrieval system