KEGG   Chlamydomonas reinhardtii: CHLRE_10g453600v5
Entry
CHLRE_10g453600v5 CDS       T01039                                 
Name
(RefSeq) uncharacterized protein
  KO
K21706  acyl-lipid omega-(9-4) desaturase [EC:1.14.19.12]
Organism
cre  Chlamydomonas reinhardtii
Brite
KEGG Orthology (KO) [BR:cre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHLRE_10g453600v5
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.12  acyl-lipid omega-(9-4) desaturase
     CHLRE_10g453600v5
SSDB
Motif
Pfam: FA_desaturase Cyt-b5 Pox_D5
Other DBs
NCBI-GeneID: 5723905
NCBI-ProteinID: XP_001698534
UniProt: Q2HWK7 A0A2K3DBB8
Position
10:complement(4705915..4710547)
AA seq 476 aa
MCRPTDSDSGPALPSIPHQYWIIHGATYDLASYIKSHPGGDEAILLGRGRDCTELFEQYH
VLNNKHLRVLERFRVTLPAAKVATNNLKEDMVSTISAFEGEEADAAAVVGIQQPAAPARV
AHQSDPFYEDIKAMVRAHGNTKMSAPFVILHCLHVVGLIWSMKLWWQGAFISAFILPYFL
WVLCAAMVHDGGHFAHSKRPLVNKLLTHTGALFTNSVGCWYLQHNILHHSYTNLVGKDGD
LDSHHPYMRIHPEQSMLPANIHHAVRFFSHLIMYNFAHIGLTMISPLSYFRGVAAQKKGT
ADAKQAQDAQTVAQYHSTVMLQLVTVGAFYITPFLRFDFSRALLLTLLPTFMMSVAFMVI
AQVSHIQMDAEAPSADLEKLHWARRMALTSVDYSQESTLWAYLTIGLNMQSLHHIVPGVS
YSQLPRLYPAYRAICEKHGIKLLERRNLAHAFWTHLQTLWVLSKTHSFVEVARKLA
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtgcaggcctaccgattccgactcggggccagccctgcccagtatcccgcaccagtat
tggatcatccatggtgcaacttacgacctggccagctatatcaagtcgcacccaggcggc
gacgaggccatcctgctaggacggggccgcgactgcactgagctcttcgagcagtaccat
gtgcttaacaacaagcacttgcgtgtgctggagcggttccgcgtcactctgccggcggct
aaggtggcgaccaacaacctgaaggaggacatggtgtcgaccatcagcgcgttcgagggc
gaggaggcggacgcagcggccgtggtgggcatccagcagcctgctgcacccgcccgcgtt
gcgcaccagtcggatcccttttacgaggacatcaaggcaatggttcgcgctcacggcaac
accaaaatgtccgctccgtttgtgatcctccactgcctgcacgtcgtcggcctcatctgg
tctatgaagctgtggtggcagggtgccttcatctcggcattcatcctgccctatttcctc
tgggtgctttgtgcggccatggtgcatgatggcgggcacttcgcacacagcaagcggcca
ctcgtcaacaagctgctgacgcacacgggtgccctcttcaccaacagcgtgggctgctgg
tacctgcagcacaacatcctgcaccactcctacaccaacctggtcggcaaggacggcgac
ctggactcgcaccacccctacatgcgcatccacccggagcagtccatgctccccgccaac
atccaccacgccgtccgcttcttcagccacctcatcatgtacaacttcgcgcacatcggc
ctgaccatgatctcgccccttagctacttccgcggcgtggccgcgcagaagaagggcacc
gccgacgccaagcaggcgcaggacgcgcagacggtggcgcagtaccacagcaccgtgatg
ctgcagttggtgacggtgggggcgttctacatcacgcccttcctgcgcttcgacttcagc
cgcgcgctgctgctgacgctgctgcccaccttcatgatgagcgtggccttcatggtgatt
gcccaggtgtcccacattcagatggacgcggaggcgccctccgccgacctggagaagctg
cactgggcccgccgcatggcgctcacgtccgtggactactcgcaggagtcgacgctgtgg
gcctacctgaccatcgggctcaacatgcagtcgctgcaccacatcgtgccgggcgtgtcg
tacagccaacttccgcgcctgtaccctgcctaccgcgccatctgcgagaagcacggcatc
aagctgctggagcgccgcaacctggcgcacgccttctggacgcacctgcagacgctgtgg
gtgctgtccaagacgcacagctttgtggaggtggcgcgcaagctggcgtaa

DBGET integrated database retrieval system