KEGG   Citrobacter rodentium: ROD_21691
Entry
ROD_21691         CDS       T01145                                 
Symbol
wfaP
Name
(GenBank) glycosyltransferase WfaP
  KO
K21363  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase [EC:2.4.1.305]
Organism
cro  Citrobacter rodentium
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cro01005]
    ROD_21691 (wfaP)
Enzymes [BR:cro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.305  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase
     ROD_21691 (wfaP)
Lipopolysaccharide biosynthesis proteins [BR:cro01005]
 O-antigen repeat unit
  ROD_21691 (wfaP)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_tranf_2_4 DUF3144
Other DBs
NCBI-ProteinID: CBG88918
UniProt: D2TQI6
Position
complement(2265137..2265898)
AA seq 253 aa
MDDYLVSIIMPSFNSEHTISASISSVLQQTYTNWELLVCDDNSIDGTRSKVLEFADSRIK
LLINEYAKGAAGARNTSLKYASGRFIAFLDSDDIWGANKLEMQISMMLKNNISFMYGNYE
IINNNSIVGKFVAPQKITYNKLLKNCGIGCLTVVLDRDLLNPFSFPFVYKEDYYLWLSIL
KDNNISAINCGFICAKYRLSQSSISSNKFKELKRQWDVLGDFVGNPLVRIYYLLSYIVIG
IKKHAFDYKNGIK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggatgattatttagtatcaattattatgccttcttttaactcagagcatacgatttct
gcatcaattagttccgtgttacagcaaacatatactaattgggaattgctcgtttgcgat
gataattcgatcgatggtacaagatctaaagttttagagtttgcagattcaagaattaaa
cttttaataaatgaatacgcaaaaggagcagcaggcgctagaaatacctcattaaaatat
gcaagtggtcgatttatagcttttttagatagtgatgatatatggggtgctaacaaatta
gagatgcaaatatctatgatgttaaagaataatatttcttttatgtatggtaattatgaa
attataaataataattcaatagttggtaaatttgtagctccccaaaaaatcacctacaac
aaattgctaaaaaattgtggcatcggttgtttaactgttgttttagacagagacttacta
aatcccttcagctttcctttcgtatacaaagaagattattatctctggctgagtattcta
aaagataacaatatcagtgcaattaattgcggctttatatgtgctaaatatagactttca
caaagttcaatttcatctaataaatttaaagagttgaaaaggcaatgggatgttttgggg
gattttgttggaaacccattagttcgtatatattatttactaagttatattgttatcggt
ataaagaaacatgcatttgactataagaacggtataaaatga

DBGET integrated database retrieval system