KEGG   Chlorocebus sabaeus (green monkey): 103246766
Entry
103246766         CDS       T04361                                 

Definition
(RefSeq) cytochrome P450 3A8
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00140  Steroid hormone biosynthesis
csab00591  Linoleic acid metabolism
csab00830  Retinol metabolism
csab00980  Metabolism of xenobiotics by cytochrome P450
csab00982  Drug metabolism - cytochrome P450
csab00983  Drug metabolism - other enzymes
csab01100  Metabolic pathways
csab04976  Bile secretion
csab05204  Chemical carcinogenesis - DNA adducts
csab05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    103246766
   00591 Linoleic acid metabolism
    103246766
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103246766
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103246766
   00982 Drug metabolism - cytochrome P450
    103246766
   00983 Drug metabolism - other enzymes
    103246766
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    103246766
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    103246766
   05207 Chemical carcinogenesis - receptor activation
    103246766
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:csab00199]
    103246766
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     103246766
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     103246766
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     103246766
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     103246766
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     103246766
    1.14.14.-  
     103246766
Cytochrome P450 [BR:csab00199]
 Cytochrome P450, animal type
  CYP3 family
   103246766
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 103246766
NCBI-ProteinID: XP_008016801
Position
28
AA seq 504 aa
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNVLSYRKGFWQF
DMECYKKYGKVWGFYDGRQPVLAITDPNMIKTVLVKECYSVFTNRRPILPMPFLESAVAG
SQXXXXWKRIRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRRETETGKPVTVKDVFGAY
SMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFLIPILEVLNVS
IFPRKVTSFLRKSVKRIKESRLKDTQKHRVDFLQLMIDSQNSKDTESHKALSDLELVAQS
IIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDTVLPNKAPPTYDTVLQMEYLDMV
VNETLRIFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHHDPKYWTEPEKFLPERF
SKKNNDNIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRL
GGLLQTEKPIVLKIESRDGTVSGA
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggacctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatttatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctttgcctttattgggaaatgttttgtcctaccgtaagggcttttggcagttt
gatatggaatgttataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccaattcttccaatgccatttttggaaagtgcagtggccgga
tctcagnnnnnnnnnnaatggaagagaatacgatcattgctgtctccaaccttcaccagc
ggaaaactcaaggagatggtccctatcattgccaagtatggagatgtgttggtgagaaac
ctgaggcgtgaaacagagacaggcaagcctgtcaccgtgaaagacgtctttggggcctac
agcatggacgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatcca
caagacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagatccattc
tttctctcaataacaatcttcccatttctcatcccaattcttgaagtattaaatgtctct
atttttccaagaaaagttacaagttttctaagaaaatctgtaaaaaggataaaagaaagt
cgcctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcag
aattcgaaagacactgagtcccacaaagctctgtctgatctggagctcgtggcccaatca
attatcttcatttttgctggctatgaaaccaccagcagtgttctctccttcattatgtat
gaactggccactcaccctgatgtccagcagaagctgcaggaggaaattgatacagtttta
cccaataaggcaccacccacctatgatactgtgctacagatggagtatcttgacatggtg
gtgaatgaaacgctcagaatatttccaattgctatgagacttgagagggtctgcaaaaaa
gatgttgaaatcaatgggatgttcatacccaaaggggtggtggtgatgattccaagctat
gctcttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttc
agcaagaagaacaatgacaacatagatccttacatatacacgccctttggaactggaccc
aggaactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtc
cttcagaacttctccttcaaaccttgtaaagaaacacagatcccgctgaaattacgctta
ggaggacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggacc
gtaagtggagcctga

DBGET integrated database retrieval system