KEGG   Camelina sativa (false flax): 104702938
Entry
104702938         CDS       T05044                                 

Name
(RefSeq) tricyclene synthase, chloroplastic-like
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00902  Monoterpenoid biosynthesis
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    104702938
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     104702938
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 104702938
NCBI-ProteinID: XP_010417167
Position
7
AA seq 593 aa
MATLGQIGSALIYSNALPKTLPRPKASACTIVAKMTPRDDKSTIVPRRSANYQPSLWDHH
HIISVENGYAKDKNVRERDLLKEKVRKMFDDEKKTYLDQLEFIDDLHKLGVSYHFEAEIK
NFLISSYQKDRINVGECDLHATALEFRLFRQHGFNVSEDVFDVFMENCGKYIYDSDDING
LLSLYEASYLSTKSDTKLKILIRPCATQQLRDFVDTHSNEDFGSCDIGEMVVQALDMPYH
WRMRRLATRWYIDVYGKRRNKNLVVDELAKIDFNIVQAIHQEELKYVSRWWRETGLGKQL
HFTRDRIVENYFWTIGQIQEPQYGYVRRIMTKINSLLTTIDDIYDIYGTLEELQLFTVAF
ENWDINCLDELPEYMRLCFCVVYNEVNSIGCDVLREKNINVIPFLKKSWTDVCKAYLIEA
KWYKRGHKPNLEEYMQNAWISISAPTIFLHFYCVFSDQLSVQVLETLSKHQQNLVRSSAS
VFRLANDLVTSPDELARGDVHKSIQCYMNETGASEEKASSHVRQMINDLWDEMNYEKMAH
NSSLLNHDFMETVINLARMSLCMYQYGDGHGSPEKAKIVDRVMSILFNPIPLD
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggccactctagggcagataggttcagctcttatttacagtaatgcccttccgaagact
cttccacgtcctaaggcttctgcatgcaccattgtggccaaaatgacaccacgtgatgat
aagtcaaccatagttcctcgccgttctgcaaactatcagccttctctttgggaccatcac
catatcatctcagtggaaaatggatatgcgaaagataaaaacgtacgggagagagatttg
ttgaaggaaaaagtgagaaagatgttcgatgatgagaaaaagacttatctcgaccaattg
gagttcattgacgatctacataaactcggggtttcatatcattttgaagcggaaatcaaa
aactttttaatatcttcttatcagaaagatagaataaacgtcggggaatgtgacttacat
gccaccgcactcgaattccgacttttcagacaacatggtttcaatgtttcagaagatgta
ttcgatgttttcatggaaaactgtgggaagtatatatatgacagtgatgatataaatggt
cttctatctctttatgaagcgtcatatctttcgacaaagtcggatactaaactgaaaata
ttaatcagaccttgcgcaacacaacaactcagagattttgttgatactcatagtaatgaa
gattttgggtcgtgcgacatcggggagatggtggtccaagcgttagatatgccctaccat
tggcgaatgagaaggctagctacgagatggtacatagatgtgtatggaaagagacgtaat
aagaaccttgtcgtagatgaattggccaagatcgatttcaacatcgtacaagccattcat
caagaagaactcaaatacgtttccaggtggtggagggagacgggtttaggtaagcaactc
cactttacaagggacagaatagtagaaaattatttttggacgatcggacaaatccaagag
cctcaatatggatacgttcgacgaataatgactaaaataaattcacttcttactactatt
gatgatatctacgatatctatggcactcttgaagaactccaacttttcactgtcgcgttt
gaaaattgggacataaattgtcttgatgaactccccgagtacatgaggttgtgtttttgt
gttgtatacaatgaagtcaatagcatcggatgtgatgtactcagagaaaaaaatatcaac
gtgattcccttcctcaaaaaatcttggacagatgtatgcaaggcatatttaatagaagcc
aagtggtacaaaagaggacacaaaccaaatctggaagagtacatgcaaaatgcttggatt
tcaatatcggcccctacgatatttcttcacttctactgcgtgttttccgaccaactctct
gttcaggtcttggagactttgtccaaacaccaacaaaacctcgtccgaagctctgcctcc
gtgttccgtctagccaacgaccttgtaacctcaccggatgaattggcgagaggagacgtc
cataaatccatccaatgttacatgaatgagaccggagcttcagaggagaaggcgagttcg
cacgtgcgacagatgatcaacgacctgtgggatgaaatgaattacgaaaaaatggctcat
aactcttcgctactcaatcatgattttatggaaactgtgataaatttggcacgtatgtca
ctatgcatgtatcagtatggcgatggccatggctctcccgaaaaagccaaaattgttgat
cgtgtaatgtctatactcttcaatccgattcctttagattga

DBGET integrated database retrieval system