KEGG   Camelina sativa (false flax): 104733459
Entry
104733459         CDS       T05044                                 
Name
(RefSeq) terpenoid synthase 8
  KO
K22467  rhizathalene A synthase [EC:4.2.3.195]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104733459
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.195  rhizathalene A synthase
     104733459
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2
Other DBs
NCBI-GeneID: 104733459
NCBI-ProteinID: XP_010451341
Position
12:12912009..12918422
AA seq 596 aa
MQTINFFAPKHRIQISLSPPTHLTPVSFPLTACPIKPAKLFHLEATSGDGQESNRKFEKF
PPSVWTNRFHSVQVDASEMDALRQEIDTLIPSVKKELMSSQGIDSMKKNILMIYLLVSLG
LAYHFEDEIEECLKEGFEKIEEMMAGEDNLYTISIVFWVFRTHGHHMSSDVFQKFRESSG
NFKGCISGDAKGMLALYEAAQLRTTTDYIMEEALSFASSNLELLAADGKCPPHLSKHIRN
ALGLSQHKNMEMLVAVGYISFYEHEKDHDKMLLKFAKLNFNLLQLHYLEELAIVTKWYRD
QDFASNLPPYFRYVIAENHFFVIGMYFEPKFSQKRIMLTKYFTALVLLDDTFDRYASRPE
AESLANSLERWAPDDAMEKQPHYLKFVFKFLVDCFEEFERELAPEGSSYCVKATREEFKI
YVKANFDLAKCAQAGHVPSFKEYMELGVVELGVYATLAGTLMGMGYIGNEGVYEWLKSRP
KLLLSLSIYGRLLNDIAGFEGDMREYVSTAVNCYMKQYGVSKMEAIRDLRNLITYNNKII
NEEFLKTTDVPRQIRKLPFNIARALNVSYNEGEGFTYTKGKVDEYITSLFVTRIFL
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgcaaacgataaatttttttgcaccaaaacatagaattcaaatctctctttctcctcct
actcatttaactcctgtcagctttccactgacggcatgtccaattaagcctgcgaaactt
tttcatttggaggcaactagtggagatggtcaagaaagtaaccgcaagttcgaaaagttt
ccaccttctgtatggactaaccgcttccactctgttcaggtcgatgcctccgaaatggat
gcgcttaggcaagagatcgatacgcttatcccgagtgtgaagaaggaactcatgtcttcc
caaggcattgactcgatgaagaaaaatatcctgatgatatatttgctggttagccttggt
ctcgcttatcacttcgaagatgagattgaagagtgtctcaaagagggtttcgaaaagata
gaggagatgatggctggtgaagataatttgtatacaatttcaatcgtcttctgggttttc
aggacacacggtcaccacatgtcatccgacgtatttcagaaattcagagaaagcagtgga
aattttaaaggatgcattagtggggatgctaagggtatgttggccttgtatgaggccgca
caattgagaacgactacagattatataatggaagaagcattgagctttgcatcgagcaac
ttggagttgttagctgcagatgggaagtgcccacctcatctctcaaagcatatacgaaat
gctctaggactatctcagcataaaaatatggagatgttagttgctgtgggatacatctca
ttctatgaacatgaaaaagaccacgacaaaatgctgctaaaatttgctaaactcaatttc
aacttattgcagctccattaccttgaagagctcgcaatcgttacaaaatggtacagggac
caggattttgcatctaacttgccaccttacttcagatacgtaatcgcagagaatcatttc
tttgtaatagggatgtactttgagccaaaattctcgcaaaagcggattatgctgactaag
tacttcacggctttagtacttttagatgacacttttgatagatacgcatctcgtcccgag
gctgaaagcctcgccaatagcctggagaggtgggctcctgatgacgctatggagaaacag
ccacattatttgaaattcgtgtttaagtttttagtggattgcttcgaagagtttgaaaga
gaattggcgccagaaggaagctcttactgtgtaaaagccacacgagaagagttcaagata
tatgtgaaagccaactttgatcttgcaaaatgcgcacaagcgggtcacgtgcctagtttt
aaggagtacatggaacttggtgtggtcgagcttggagtatatgcgactttggcaggcact
ttgatgggcatgggatatatcggtaatgagggagtttatgagtggctcaaatccagacca
aaattactcctatcattatctatatatggacgtctgttaaatgatatagctggattcgag
ggtgacatgagagaatatgtcagtactgcggtcaactgttatatgaagcaatatggtgta
tccaaaatggaagctattagagaccttcgaaacttaattacatacaacaataagataata
aacgaagagtttttgaagacaactgatgtaccacgccaaatccggaagctacccttcaac
attgcacgcgcgctcaatgtctcctacaatgaaggtgaaggattcacttataccaaagga
aaagtcgatgagtatatcacttctttgtttgtaacacggatttttctttaa

DBGET integrated database retrieval system