KEGG   Camelina sativa (false flax): 104735438
Entry
104735438         CDS       T05044                                 

Name
(RefSeq) 3-isopropylmalate dehydrogenase 3, chloroplastic isoform X1
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00290  Valine, leucine and isoleucine biosynthesis
csat00966  Glucosinolate biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    104735438
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    104735438
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     104735438
    1.1.1.-  
     104735438
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 104735438
NCBI-ProteinID: XP_010453537
Position
13
AA seq 408 aa
MASFLQTNIRLSSNKIVPGKYTSLNNKYHAPSLIRCAAASPGKKRFNIALLPGDGIGPEV
ISVAKNVLQKAGSLEGLEFDFQEMPVGGAALDLVGVPMPEESFTAAKNSDAILLGAIGGY
KWDKNEKHLRPEMALFYLRRDLKVFANLRPATVLPQLADASTLKKEVAEGVDMMIVRELT
GGIYFGEPRGISINENGEEVGISTEIYAAHEIDRIARVAFETARKRRGKLCSVDKANVLD
ASVLWRKRVTALASEYPDVELSHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMI
TGSIGMLPSASLSESGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAK
RIEDAVMDALSRGFRTGDIYSPGNKLVGCKEMGAEVLKSVDAKVPATV
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcgtcgtttttgcaaacgaacatccgactaagttccaacaagatcgtccccggaaaa
tatacttctttgaataataagtatcatgcaccgtctctaattaggtgcgccgcagcttca
ccggggaaaaaacggtttaacatcgctctccttcccggtgacggcatcggtccagaagtt
atatctgttgctaagaatgtgcttcagaaagctggatctcttgaaggactggagtttgat
ttccaagagatgcctgtcggaggagcagccttggatttggttggagttcccatgccagag
gaatctttcacagctgctaaaaattctgatgctatacttcttggagctattggagggtat
aaatgggacaagaatgagaaacatctgagacctgagatggctttgttttacctacgaaga
gatctcaaagtctttgcaaatttaagacctgctacagttttgccacagttagctgatgct
tccacattgaagaaagaagtagcagaaggtgttgatatgatgattgtaagagagctcact
ggaggtatttattttggagagccaagaggaatatctattaatgaaaatggcgaagaagtc
ggcattagtacagagatctacgctgctcacgagatcgacagaattgctcgtgttgcgttt
gagactgctaggaaaaggcgcggcaagctgtgttctgtcgacaaagccaatgtgttggat
gcatcagtactgtggaggaaaagagtaacagcgttagcctctgaatatccagatgttgaa
ctatcacatatgtatgttgataatgctgcaatgcagcttatccgtgacccgaaacagttt
gacacaatcgtcaccaataacatttttggtgatatattatctgatgaagcttcaatgatc
actggaagcattggaatgcttccatctgctagtctcagtgaatcgggacctggactcttt
gaacctatacatggttctgcaccagatatagctggacaagacaaggcaaacccattggcc
actattctcagcgccgcaatgcttctgaaatatggacttggagaagaaaaagctgcaaag
aggattgaagacgcggtcatggatgctctgagcagagggttcagaactggagacatctac
tcccccggaaataaactggtgggatgcaaagaaatgggagcggaggtgctcaaatcagtg
gacgccaaagttccagctactgtttaa

DBGET integrated database retrieval system