KEGG   Corynebacterium suranareeae: N24_1278
Entry
N24_1278          CDS       T07007                                 

Symbol
mhpA
Name
(GenBank) 3-(3-hydroxyphenyl)propionate hydroxylase
  KO
K20943  resorcinol 4-hydroxylase (NADPH) [EC:1.14.13.219]
Organism
csur  Corynebacterium suranareeae
Pathway
csur00362  Benzoate degradation
csur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csur00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N24_1278 (mhpA)
Enzymes [BR:csur01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.219  resorcinol 4-hydroxylase (NADPH)
     N24_1278 (mhpA)
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 NAD_binding_8 FAD_binding_2 HI0933_like ApbA Pyr_redox FAD_oxidored Thi4 NAD_Gly3P_dh_N Lycopene_cycl Pyr_redox_3
Other DBs
NCBI-ProteinID: BAU95540
UniProt: A0A160PSX8
Position
1363663..1365255
AA seq 530 aa
MSLNEFDTDVCIVGGGPTGTLLAVLLGQKGHRVTILEKWPTFYERPRAVTFDHEIARILG
YIGVDAENDEAIDYHTDSYDWKNAAGETLLEVDWTSMTDSGWRTRYWFYQPELEKRLRDL
ALSMDSVEIRCGFTAVGLTQDEDSATIHGVITDNPEDIPADAPREDIRARYVVGADGANS
FVRNTLGLEMNDLGYFFDWLILDLKPTQKIDYGIAHWQLCDPKRPTTIVPGGPGRRRWEF
MALPGEDLNQLASEESAWKLLEPWDVTPEKAILERSAVYRFQARWAQEWRSGRALIAGDA
AHLMPPFAGEGMCAGLRDSLALAWRLDLVLGGKADDALLDTYGEERREHVHYYIDFSMEL
GNVICIADEKEARLRDERMIEELKSKDGVPVNTDVAHLGPGVWIKESAHGGELAKQGIVE
YKGQKARFDDAVGRGWTVLGLNIDPRTILNEASLATLESIGAIVESVGDSESAVVDTEGL
YSRWIGEAGAQFIITRPDFYVYSTAADAEELQQQIARLSDLLHLNSTVNA
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtcacttaatgaatttgataccgatgtctgcatcgtcggtggaggtccgaccggaacc
ctgctcgctgttttgctcggccaaaagggccatcgcgtcaccatcttggaaaaatggcct
actttttacgagcgtccacgagctgtcaccttcgatcatgaaattgcacgcattcttggc
tacatcggtgtcgatgcagaaaatgatgaggcaattgactatcacacagacagctatgac
tggaagaacgcagcaggagagaccctcttggaggttgactggacttccatgacagattcc
ggatggcgcacacgctactggttttaccagccagaattggaaaagcgcctgcgtgatctg
gccctgagtatggattcggtggagattcgttgtggatttaccgctgttggtcttacccaa
gacgaggattccgccacgatccatggagttatcactgataaccctgaagacattccggca
gatgcaccgcgtgaagatatccgagcacgctacgttgtcggtgcggatggcgcgaacagc
ttcgtgcgcaacactcttggcctagaaatgaacgatcttggatacttcttcgattggttg
atcctggatctcaagccaacccagaaaatcgactacggaattgcgcactggcagctgtgt
gatccgaagcgtccaaccacaattgttcctggaggtccggggcgtcgtcgttgggagttc
atggcgttgcctggtgaagatctgaaccagctggcttccgaggaaagcgcgtggaagctg
ctagagccatgggacgttaccccagaaaaggccatcttggaacgttccgctgtgtatcgc
ttccaagctcgttgggctcaggaatggcgttcaggtcgagcgttgattgctggcgatgct
gctcacctcatgccacctttcgcgggcgaaggtatgtgtgctggacttcgtgattctttg
gcacttgcctggcgccttgatttggttcttggcggaaaagctgatgatgctttacttgat
acgtatggtgaagaacgtcgtgagcatgttcattactacatcgatttctccatggagctc
ggcaatgtcatttgcattgctgatgaaaaagaagcacgcttgcgcgatgaacgcatgatt
gaggagctgaagtccaaagacggggttccagttaacaccgacgttgcgcacctgggtcct
ggcgtgtggattaaggaatccgcacacggcggtgagcttgccaagcagggcattgtggaa
tacaaggggcaaaaagcgcgtttcgacgacgccgtcggccgcggctggaccgttctaggc
ctcaacattgatccacgcacgatccttaatgaggcctcccttgcaactttggagtccatc
ggagcaatcgtggaatctgtcggtgactccgaatctgcagtggtagatactgagggactt
tattctcgatggattggtgaagccggagcacagtttattatcacccgccctgatttttac
gtgtactccaccgcggcagacgcagaggaattgcagcaacagattgctcgactgtcagat
ttactccacctcaattcaactgttaacgcatag

DBGET integrated database retrieval system