KEGG   Caldalkalibacillus thermarum: HUR95_07690
Entry
HUR95_07690       CDS       T07471                                 
Name
(GenBank) alpha/beta-type small acid-soluble spore protein
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
cthu  Caldalkalibacillus thermarum
Brite
KEGG Orthology (KO) [BR:cthu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    HUR95_07690
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: QZT35095
Position
1526681..1526899
AA seq 72 aa
MDQNQRSRNTNQLLVPGVAQALDQMKIEIAQEFGVQLGAETTSRANGSVGGEITKRLVRQ
AQQQLSGQFPQQ
NT seq 219 nt   +upstreamnt  +downstreamnt
atggatcaaaaccaaagaagccgtaacaccaaccaattgcttgtacctggcgtagctcaa
gctttggatcagatgaaaattgaaatcgctcaagaatttggtgttcaacttggtgctgaa
accacttcccgtgctaacggttctgtcggtggtgaaatcaccaagcgtttagtgcgtcaa
gctcagcagcaattaagcggtcaatttccccaacaataa

DBGET integrated database retrieval system