KEGG   Cupriavidus sp. USMAA2-4: BKK79_21280
Entry
BKK79_21280       CDS       T05072                                 

Name
(GenBank) alcohol dehydrogenase
  KO
K19961  6-hydroxyhexanoate dehydrogenase [EC:1.1.1.258]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00930  Caprolactam degradation
cuu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BKK79_21280
Enzymes [BR:cuu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.258  6-hydroxyhexanoate dehydrogenase
     BKK79_21280
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ThiF AlaDh_PNT_C Sacchrp_dh_NADP TrkA_N PglD_N Pyr_redox Glu_dehyd_C
Other DBs
NCBI-ProteinID: AOY94482
UniProt: A0A1D9H3Q8
Position
2:258952..260004
AA seq 350 aa
MRCFCVTHYGQPLELIEKDIPQPQGTEVLVRVKAAGLCHSDLHIWEGYYDLGGGKKLMFA
DRGLKLPLTPSHEISGEVVAAGPDAGPVQIGLVAVVHPWIGCGQCAACRRGEENICVKPQ
SLGAVRDGGFADYVIVPHPRYLVDLSGLDPVKAAPLACAGVTTYSAIKKFGERIHEGPIV
VIGAGGLGLMAIEVLKALGGKGAIVVDVDATKRDAAQQAGALAAIDARAPDAAQQIIQAT
DGGARAVLDLVGATPTMTLALDSSARGGHVVVVGLMGGDITLSLPVIPMKPLRIEGSYVG
TLPELRELVALMRDGKIQPTPVRSRPLDEVNDALIALSQGKVIGRTVLVP
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgcgttgtttttgtgtgactcactatggccagccgctcgagctgatagagaaggacatc
ccgcagccgcagggcaccgaggtgctggtgcgggtcaaggcggcggggctgtgccattcc
gacctgcacatctgggaaggctattacgatctcggcggcggcaagaagctcatgttcgcc
gaccgcggcctcaagctgccgctgacgccgagccacgagatctccggcgaggtcgtcgct
gcgggcccggacgccggtccggtgcagatcggactcgtcgcggtcgtgcatccgtggatc
ggctgcggccagtgcgcggcatgccggcgcggcgaggagaacatctgcgtgaagccgcag
tcgctcggcgcagtgcgcgacggcggcttcgcggactatgtgatcgtgccgcatccgcgc
tatctggtcgatctcagcgggctcgatccggtgaaggccgcgccgctcgcatgcgcgggc
gtcacgacttactcagcgatcaagaagttcggcgagcggattcatgaagggccgatcgtc
gtgatcggcgcgggcggcctcgggctgatggcgatcgaggtgctgaaggcgcttggcggc
aagggcgcgatcgtggtcgacgtcgacgcgacgaagcgcgacgccgcgcagcaggccggc
gcgctcgccgccatcgacgcgcgcgcgccggacgccgcgcagcagatcatccaggcaacg
gatggcggcgcgcgcgcagtgctcgatctcgtcggtgcgacgccgaccatgacgctcgcg
ctcgactcgtccgcacgcggcggacacgtggtggtcgtcgggctgatgggtggcgacatc
acgctgtcgctgccggtcatcccgatgaagccgctgcggatcgaaggcagctatgtcggc
acgctgcccgagttgcgcgagctcgtcgcgctgatgcgcgacggcaagatccagccgacg
cctgtgaggagccgcccgctcgacgaagtcaacgacgcgctgatcgcgctgtcgcagggg
aaggtgatcgggcgcaccgtgctggttccataa

DBGET integrated database retrieval system