KEGG   Chromobacterium vaccinii: BKX93_07105
Entry
BKX93_07105       CDS       T04565                                 

Name
(GenBank) monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00404  Staurosporine biosynthesis
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
cvc02024  Quorum sensing
Module
cvc_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    BKX93_07105
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BKX93_07105
Enzymes [BR:cvc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     BKX93_07105
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase Pyr_redox_2 NAD_binding_8 DAO Pyr_redox FAD_binding_2 GIDA SE HI0933_like FAD_oxidored 3HCDH_N ApbA
Other DBs
NCBI-ProteinID: AOZ49785
UniProt: A0A1D9LEZ9
Position
complement(1554149..1555438)
AA seq 429 aa
MKKAIIVGGGLAGGLTAIYLAKRGYEVHVVEKRGDPLQDLSSYVDVVSSRAIGVSMTVRG
IKSVLAAGIPRAELEACGEPIVAMAFSVGGQHRMRPLKPLEDFRPLSLNRAAFQKLLNKY
ANLAGVRYYFEHKCLDVDLDGKSVLIQGPDGQPQRLQGDMIIGADGAHSAVRQAMQSGLR
RFEFQQTFFRHGYKTLVLPDAGALGYRKDTLYFFGMDSGGQFAGRAATIPDGSVSIAICL
PYSGSPSLTTTDESVMRAFFDRYFGGLPQDAREEMLRQFLAKPSNDLINVRSSTFHYKGN
VLLLGDAAHATAPFLGQGMNMALEDARAFVELLDRHQGDQDKAFPEFTKLRKVQADAMQD
MARANYDVLSCSNPVFFMRARYTRYMHSKFPGLYPPDMAEKLYFTSEPYDRLQQIQRKQN
VWYKIGRVN
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgaaaaaagcaatcatagtcggaggcgggctcgccggcggtttgaccgccatctacctg
gcgaagcgcggctacgaggtccacgtggtggaaaagcgcggcgatccgttgcaggacctg
tcgtcctacgtggacgtggtcagctcgcgggcgataggcgtcagcatgacggtgcgcggc
atcaagtcggtgttggccgccggcatcccgcgcgcggagctggaggcctgcggcgagccc
atcgtggcgatggcgttctcggtcggcggccagcatcggatgcggccgctgaagccgctg
gaggatttccgtccgctgtcgctcaaccgcgcggcgttccagaagctgctgaacaaatac
gccaatctggccggcgtccgctattacttcgagcacaagtgtctggatgtggatctggac
ggcaagtcggtgctgatccagggcccggacggccagccgcagcggctgcagggcgatatg
atcatcggcgccgacggcgcgcactccgcggtgcggcaggcgatgcagagcggcctgcgc
cgcttcgagttccagcaaacctttttccgccacggctacaagacgctggtgctgccggac
gccggggcgctgggctatcgcaaggacacgctgtactttttcggcatggattccggcggc
cagttcgccggccgcgccgccaccataccggacggcagcgtcagcatcgccatttgcctg
ccctacagcggcagccccagtctgaccaccaccgacgaatcggtgatgcgcgccttcttc
gaccgttacttcggcggcctgccgcaggacgcgcgcgaagagatgctgcgccagttcctg
gccaaacccagcaatgatctgatcaatgtccgctccagcactttccattacaagggcaat
gtgctgctgctgggcgacgccgcccatgccaccgcgcccttcctcggccagggcatgaat
atggcgctggaagacgctcgagccttcgtcgagctgctggaccgccatcagggggatcag
gacaaggcctttcccgagttcaccaagctgcgcaaggtgcaggcggacgcgatgcaggac
atggcgcgcgccaactacgacgtgctcagctgctccaaccccgtcttcttcatgcgggcc
cgctacacccgctacatgcatagcaagtttcccggcctttacccgccggatatggcggag
aagctgtatttcacgtcggaaccgtacgacaggctgcagcagatccagagaaagcagaac
gtttggtacaagataggaagggtcaactga

DBGET integrated database retrieval system