KEGG   Cycloclasticus sp. P1: Q91_2218
Entry
Q91_2218          CDS       T02265                                 

Gene name
dsbA2
Definition
(GenBank) Isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00626  Naphthalene degradation
cyq01100  Metabolic pathways
cyq01120  Microbial metabolism in diverse environments
cyq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Q91_2218 (dsbA2)
Enzymes [BR:cyq01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     Q91_2218 (dsbA2)
SSDB
Motif
Pfam: DSBA Suv3_N
Other DBs
NCBI-ProteinID: AFT68251
UniProt: K0CA16
Position
complement(2322103..2322699)
AA seq 198 aa
MQESIDFYFDMMSPFSYLAHTQLPDLARKYGLTVKYLPMSIPVAKIAAGNYGPSNREVPA
KIKVMLQDIKRWAAHYDVPFTFPKNLEIEPWNIGVLYANDKDQAEAYVNAAYAKIWADGC
DPTDMAELSQVADQLGWNADEFIAYVQSNEGQTRFRKACVEAHKEGVFGAPIMMLDDQAW
WGNDRFMFMEEYLKDRKN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcaagaatcaatagacttttattttgacatgatgagcccatttagttatttggctcat
actcagttacccgatttggcgagaaagtatggtttaactgttaagtatttgccgatgagt
atcccagtagcaaaaattgctgcgggtaattacgggccttcaaatagagaggtgcctgcc
aaaattaaagtgatgttgcaagacattaaacgctgggcagcacattatgatgtgccgttt
acgtttcctaaaaaccttgaaatagagccttggaatattggtgttttatatgccaatgat
aaagatcaagcagaagcctatgtcaatgcagcttatgcaaagatctgggcagatggttgt
gacccaacagacatggccgagctatcgcaagtagcagatcaactgggttggaatgcggat
gagtttattgcctatgtgcagtcaaatgaagggcagactcgttttcgtaaagcttgtgta
gaggcacataaagagggtgtctttggtgcccctattatgatgttagatgaccaagcctgg
tggggtaatgatcgcttcatgtttatggaagagtatcttaaagatcggaaaaattaa

DBGET integrated database retrieval system