KEGG   Cycloclasticus zancles: CYCME_2536
Entry
CYCME_2536        CDS       T02780                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
cza  Cycloclasticus zancles
Pathway
cza00626  Naphthalene degradation
cza01100  Metabolic pathways
cza01120  Microbial metabolism in diverse environments
cza01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cza00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CYCME_2536
Enzymes [BR:cza01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     CYCME_2536
SSDB
Motif
Pfam: DSBA Suv3_N
Other DBs
NCBI-ProteinID: AGS40841
UniProt: S5TAS5
Position
complement(2571979..2572575)
AA seq 198 aa
MQESIDFYFDMMSPFSYLAHTQLPDLARKYGLTVKYLPMSIPVAKIAAGNYGPSNREVPA
KIKVMLQDIKRWAAHYDVPFTFPKNLEIEPWNIGVLYANDKDQAEAYVNAAYAKIWADGC
DPTDMAELSQVADQLGWNADEFIAYVQSNEGQTRFRKACVEAHKEGVFGAPIMMLDDQAW
WGNDRFMFMEEYLKDRKN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcaagaatcaatagacttttattttgacatgatgagcccatttagttatttggctcat
actcagttacccgatttggcgagaaagtatggtttaaccgttaagtatttgccgatgagt
atcccagtagcaaaaattgctgcgggtaattacgggccttcaaatagagaggtgcctgcc
aaaattaaagtgatgttgcaagacattaaacgctgggcagcacattatgatgtgccgttt
acgtttcctaaaaatcttgaaatagagccttggaatattggtgttttatatgccaatgat
aaagatcaagcagaagcctatgtcaatgcagcttatgcaaagatctgggcagatggttgt
gacccaacagacatggccgagctatcgcaagtagcagatcaactgggttggaatgcggat
gagtttattgcctatgtgcagtcaaatgaagggcagactcgttttcgtaaagcttgtgta
gaggcacataaagagggtgtctttggtgcccctattatgatgttagatgaccaagcctgg
tggggtaatgatcgcttcatgtttatggaagagtatcttaaagatcggaaaaattaa

DBGET integrated database retrieval system