KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0267464
Entry
DDB_G0267464      CDS       T00245                                 

Symbol
polA
Name
(RefSeq) 3'-5' exonuclease domain-containing protein
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0267464 (polA)
   03410 Base excision repair
    DDB_G0267464 (polA)
   03420 Nucleotide excision repair
    DDB_G0267464 (polA)
   03440 Homologous recombination
    DDB_G0267464 (polA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0267464 (polA)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0267464 (polA)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DDB_G0267464 (polA)
DNA replication proteins [BR:ddi03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     DDB_G0267464 (polA)
DNA repair and recombination proteins [BR:ddi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     DDB_G0267464 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     DDB_G0267464 (polA)
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc DNA_pol_A_exo1 HHH_2 Dehydrin DUF3913
Other DBs
NCBI-GeneID: 8616365
NCBI-ProteinID: XP_647557
dictyBase: DDB_G0267464
UniProt: Q8I7W9
Position
1
AA seq 1369 aa
MITISKQYKKNLNNLKTPLITNFFINSFSNNYNNYNNKYFTNDNIIINPITNQLDNNNSN
NSNNSNNNNNNSNNSNNNNNSDDIKNDIKNDGINIIKKEIPKTKKMKIKIKSNVPYLSLS
NGEKIYFKKPTNVIKKTIQQIPSSFVLNDYQMPFQQHPQIVDSPIIDTDFQFNSYNYGQD
TFNTNNHHHRHSIEQMNFENIVNQITSSSSSSSSSSKTINVNNKKDSILNNIENNVNNNN
VPIIGDTTTTTSTTMTTTMTTIKDIKIEKRKKHTVLIDGTLMAYKANATTPSLTNEGMNV
NVLYGFMRSMLKVIDELKPIDSIVVCFDPKGGSSFRRDLYPEYKSNRPPTPPELLQQLLL
IPEVTDSINVAFTKVDGYECDDLLATYSKLATQEGNKFIEGNDQYDPTHPESNRFNGSQV
TIVTDDKDIYQLVNDNVSVYSTRRGSMVDKQGVIDKFGFEPNKFVTFQSLIGDKVDNIPG
IPRIGEKTATDIIKKFGNLNSIIENIDQLPQKFIEPIRSSIDQLRISYQLAKLNDNVSIN
LNLDDIKYKPIDRTKFYNFLDKYNFTSIKSSVEKLNKLFSDNQEITTSTSTTNLETIKKN
YSKVEFNYIDDENIKFDEISNEEINQLKPKNVTMVRDVETARMVVSILMKQKDRFHACDT
EVIDIDLKKFSPIGHGKMICFSIYCGPQVKFHDGNSRVWVDVMDDIEGDEILQVFKEYFE
DESILKVWHNYAFDRHIFYNHGINVKGFGGDTLHMARLWNASRMNSGGYSLEALSKELLN
KPKVPIKDLFGTRKIKADGEEGKSIVIPPLERIQRDSKFILNWIEYSSLDSELTWLLREN
IHIKLRDMEWNQGTTMWDFYYLMWRPFGHLLTEMEQRGLKVDIDYLKSLEEKAYTDMEEN
RKVFLNWAKTHSPDAENMNPVSDAQIQQLFFAPVQNKKTKESLPLEKDFECDNLDGTIEV
GKTKPKKKKTFYLRGIGMESKSLTTNGWPSVDSSSLRELAGKNPIDGKYGSAYDFFVKSK
NECYKDLPIEEREQMGREASIAINALLELGSIGTLLNTFIIPLQKLADSNSRLHTSINVN
TETGRLSSKKPNLQNQPALEKDRYKIRKAFTCEPGNTLIVADYGQLELRLLAHITNCKSM
ITAFQVGGDFHSRTAMGMYPHVKEAIDRGEVLLEWDGEGEPPKPLLKNVYASERRKAKTL
NFSIAYGKTAHGLSQDWGVTLNEAKETLNRWYEDRPEVLVWQRKTIETAHKYGWTRTLMG
RYRQLPDIKGNKGMKGHAERASINTPLQGGAADIVMKAMLIIEDNKRLKELGFKLIMQIH
DELILEGPEQHADEARSIMMNLMSNPLTTPLLIDLVVDCRYAKTWYDAK
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgataacgatatcaaaacaatataaaaaaaatctaaataatttaaaaacacctttaatt
acaaattttttcataaattcattttctaataattataataattataataataaatatttt
actaatgataatataataataaatccaataaccaaccaattagataataataatagtaat
aatagtaataatagtaataataataataacaatagtaataatagtaataataataataat
agtgatgatataaaaaatgatataaaaaatgatggcataaatattatcaaaaaagaaata
ccgaaaactaaaaaaatgaaaattaaaattaaatccaatgttccatatttatcattatca
aatggtgaaaagatttattttaaaaagccaactaatgtaataaagaaaactattcaacaa
ataccatcatcattcgttttaaatgattaccaaatgccatttcaacaacatccacaaatt
gtagattctcctataatagatactgactttcaatttaatagttataattatggtcaagat
acttttaatactaataatcatcatcatcgtcactcaattgaacaaatgaattttgaaaat
atagttaatcaaataacatcatcatcatcatcatcatcatcatcatcaaaaacaataaat
gtaaataataaaaaagattcaatattaaataatattgaaaataatgtaaataataataat
gtaccaataataggtgatactactactacaacttcaacaacaatgacaacaacaatgaca
acaataaaagatattaaaattgaaaaaagaaaaaaacatactgtattaattgatggtaca
ttaatggcatataaggcaaatgcaacgacaccatcattaactaatgaaggtatgaatgtt
aatgttttatatggatttatgagatcaatgttaaaggttattgatgaattgaaaccaatt
gatagtatagtggtttgttttgatccaaaaggtggaagtagttttagacgtgatttatat
ccagaatataaatccaatagaccaccaacaccaccagaattattacaacaacttttacta
atacccgaagtcacagattcaataaatgttgcattcacaaaagtcgatggttatgaatgt
gatgatttattagcaacctattcaaaacttgccactcaagaaggcaacaaattcattgag
ggcaatgaccagtatgatccaacgcatccagagagtaatagattcaatgggtcacaagtt
acaatagtgaccgatgataaagatatttatcaattggttaatgataatgtaagtgtctac
agtactagaagaggatcaatggtagataaacaaggtgtcattgataaatttgggtttgaa
ccaaataaatttgtaacttttcaaagtttaattggtgataaagttgataacatcccaggt
ataccaagaattggtgaaaaaactgcaactgatatcataaagaaatttggtaacctaaat
tcaatcattgaaaatattgatcaattacctcaaaaattcattgaaccaattaggtcatca
attgatcaattaagaatttcttatcaattagcaaaattaaatgataatgtttcaataaat
ttaaatttagatgatattaaatataaaccaattgatagaacaaaattttataatttttta
gataaatataattttacctcaattaaaagttcagttgaaaaattaaataaactttttagt
gataatcaagaaataacaacatcaacatcaacaacaaatttagaaacaattaaaaaaaat
tattcaaaagttgaatttaattatattgatgatgaaaatattaaatttgatgaaatttca
aatgaagaaattaatcaattaaaaccaaagaatgtaacaatggttagagatgttgaaaca
gcaagaatggtagtatcgattttaatgaaacaaaaagatagatttcatgcatgtgataca
gaggttattgatattgatttaaagaaattctcaccaattggacatggtaaaatgatttgt
tttagtatttattgtggaccacaagttaagtttcatgatggtaattcgagagtatgggtt
gatgttatggatgatattgagggtgatgagattttacaagtttttaaagaatactttgaa
gatgagtcaatattaaaagtttggcataattatgcattcgatagacatattttctataac
catggtatcaacgtcaaaggcttcggtggtgatacattacatatggcaagattgtggaat
gcttctagaatgaattctggcggctattcattggaggccctaagtaaggaattattaaat
aaaccaaaggttccaattaaggatttatttggtacaaggaaaattaaagctgatggcgaa
gaaggtaaatccatagttataccaccattggaaagaattcaacgtgatagcaaattcata
ttgaattggatagaatattcatcattggattctgaattgacttggctacttcgtgaaaat
attcatatcaagttgagagacatggaatggaatcaaggtactacaatgtgggatttctac
tacctaatgtggagaccatttggacatctattgactgaaatggagcaaagagggctaaaa
gtggatattgactatttgaaatctttggaagagaaagcctataccgacatggaggagaat
agaaaggtgtttttaaattgggcaaaaacccattcaccagatgctgaaaatatgaatcca
gttagtgatgctcaaattcaacaactctttttcgcacccgttcaaaataagaaaaccaaa
gaatctttaccattggaaaaagatttcgaatgtgataatttagatggtacaattgaagtt
ggtaaaactaaaccaaagaaaaagaaaacattttatttaagaggtattggcatggaatct
aagtctttaactacaaatggctggccatcggtggattcatcgtcacttagagaattggca
ggtaaaaatccaatcgatgggaagtacggctcagcttatgatttctttgtgaaatccaaa
aatgaatgttataaagatttaccaattgaagaacgtgaacaaatgggtagggaagcatca
attgcgatcaatgctttgttagagcttggtagtatcggtacattgttgaatacatttata
ataccattacagaaattagccgactcaaattcacgtcttcatacatcaatcaatgtaaat
acagaaactggtagattatcatcaaagaaaccaaaccttcaaaatcaaccagcacttgaa
aaggatcgttataaaattagaaaagcatttacatgtgaacctggcaacacattgatcgtg
gccgattacggtcaattggagttacgtctactagctcacataactaattgtaaaagtatg
ataacagcattccaagtgggtggtgattttcatagtagaaccgcaatgggtatgtatcca
catgttaaagaagcaatcgatagaggagaggtattgttagaatgggatggagagggtgag
ccaccaaaaccactccttaaaaatgtttatgcctctgaaagacgtaaagctaaaactttg
aatttctcaatcgcctacggtaaaaccgctcatggtctatcacaagattggggtgtaacc
ctaaatgaggctaaagaaaccctcaatcgttggtatgaagatcgtccagaagttttagtt
tggcaaagaaaaaccattgaaaccgctcataaatatggttggactagaactctaatgggt
agatatcgtcaattacccgatataaaaggtaacaaaggtatgaaaggtcatgctgaaaga
gcttcaatcaataccccacttcaaggtggtgcagctgatatcgtaatgaaagcaatgctc
atcattgaagataataaacgtctaaaagaattaggtttcaaattaatcatgcaaattcat
gatgaactcatcttggaaggtcctgaacaacatgcagatgaagctcgttcaatcatgatg
aacttaatgagtaatcctttaacaactcctttattaattgatttagttgttgattgtaga
tatgctaaaacttggtatgatgcaaaataa

DBGET integrated database retrieval system