KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0270764
Entry
DDB_G0270764      CDS       T00245                                 

Gene name
MYH
Definition
(RefSeq) A/G-specific adenine DNA glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DDB_G0270764 (MYH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0270764 (MYH)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     DDB_G0270764 (MYH)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DDB_G0270764 (MYH)
 Prokaryotic type
     DDB_G0270764 (MYH)
SSDB
Motif
Pfam: HhH-GPD NUDIX_4 HHH DUF2052 YL1 DUF4746 CPSF100_C BSP_II
Other DBs
NCBI-GeneID: 8617615
NCBI-ProteinID: XP_001134477
dictyBase: DDB_G0270764
UniProt: Q1ZXP7
Position
1
AA seq 574 aa
MRKKIKIEYEEEDNENNNNLSDITEDEDNSDEDYVERKKKPTTKKTNSKVKKNNTTTTTT
TTKTSIKVKDESIESIELKPCQHSLKLHKFKNKQEIQEIRESMLGWYEKNKRDLPWRKHD
NSLDENVIAYRVWVSEIMLQQTRVATVIEYFNKWIEKWPTINDLASTTIEEVNKVWSGLG
YYRRAKNLWLGSKYVVDNFNSKIPSDVKSLLEINGIGPYTAGAISSIAFNKPVPLVDGNV
IRVLSRVRSIGANPKLSSTVKLFWELGNDLVESVENPCNFNQSLMELGATICSVQSPQCK
QCPIQSNCQAYQQEKQFIKPEPKNSISKFFQPKNNNNTNDIESSSSSTKPIVTLNLTDIC
KICQSFEDSDGPTESVCRYPKKVLKTKARDENVNVFLIHQTKSNLFLLTQRPDTGLLASL
FEAPSIIEELQSKRKIKKDKEDDNSEEEEEENDKSEESDDDDDEKNSKKRKKPTTKKTTN
KITKEFIEKEILKKLFKSSTDITIKSVKSIGTVLHKFSHINQTLTVYDCPCDFKKEPIPN
DKSKTKNICWLKLDEIQSSVGVSKQMLKCFDLIK
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgagaaaaaaaatcaaaattgaatatgaggaagaagataatgaaaataataataattta
agtgatattacagaagatgaagataatagtgatgaagattatgttgaaagaaagaaaaaa
ccaacaactaaaaaaaccaattctaaagttaaaaagaataatacaaccaccactactact
acaaccaaaacttcaattaaagttaaagatgaatcaattgaatcaattgaattaaaacca
tgtcaacatagtttaaaattacataaatttaaaaataaacaagagattcaagagattaga
gaatcaatgttaggatggtatgaaaagaataaaagagatttaccatggagaaagcatgat
aattcacttgacgagaatgttatagcttatagagtttgggtatcagagataatgttacaa
caaactagagtggccactgtaattgaatactttaataaatggattgaaaaatggccaact
atcaatgacctcgcatctacaacaattgaagaagtcaataaagtttggtcaggccttggt
tattatagacgtgctaaaaacctatggttaggttcaaaatatgtagttgacaatttcaat
tctaagattccatcagatgttaaatcattattagaaatcaatggtattggtccatataca
gctggtgcaatttcatctattgctttcaataaacctgtaccattagttgatggaaatgta
attagagtgttaagtcgtgttagatcaattggtgcaaatccaaaactatcttcaacagtt
aaattattttgggaattaggtaatgatttagttgaatctgttgaaaatccttgtaatttc
aatcaatccctaatggaattgggtgccaccatttgttctgttcaatcaccacaatgtaaa
caatgtccaattcaatcaaattgtcaagcatatcaacaagagaaacaatttataaaacct
gaaccaaaaaattcaatttcaaaattttttcaaccaaaaaataataataatacaaatgat
atagaatcatcatcatcatcaacaaaaccaatagtaacattaaatttaactgatatttgt
aaaatttgtcaaagttttgaagattctgatggtccaactgaaagtgtttgtagatatcca
aaaaaagttttaaaaacaaaagctagagatgaaaatgtaaacgtatttttaattcatcaa
acaaaaagtaatttatttttattaactcaacgtcctgatactggtttattagcatcatta
tttgaagcaccatcaattattgaagaacttcaatcaaaaagaaaaattaaaaaagataaa
gaagatgataatagtgaagaagaagaagaagaaaatgataaaagtgaagaaagtgatgat
gatgatgatgaaaagaattctaaaaaaaggaaaaaaccaacaacaaagaaaacaacaaat
aaaataacaaaagaatttatagaaaaagaaattttaaagaaattatttaaatcatcaaca
gatataacaattaaatctgttaaatctattggaacagttttacataaattctcacatatt
aatcaaacattaacagtttatgattgtccatgtgattttaaaaaagaaccaattccaaat
gataaatctaaaactaaaaatatttgttggttaaaacttgatgaaattcaatcatcagtt
ggtgtttcaaaacaaatgttaaaatgttttgatttaataaaataa

DBGET integrated database retrieval system