KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0270990
Entry
DDB_G0270990      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00071  Fatty acid degradation
ddi00410  beta-Alanine metabolism
ddi00592  alpha-Linolenic acid metabolism
ddi00640  Propanoate metabolism
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01200  Carbon metabolism
ddi01212  Fatty acid metabolism
ddi04146  Peroxisome
Module
ddi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DDB_G0270990
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DDB_G0270990
   00592 alpha-Linolenic acid metabolism
    DDB_G0270990
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0270990
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0270990
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0270990
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     DDB_G0270990
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Toxin_5
Other DBs
NCBI-GeneID: 8617350
NCBI-ProteinID: XP_646395
dictyBase: DDB_G0270990
UniProt: Q55CT6
Position
1
AA seq 692 aa
MERLSIICNHFEDNDSLESNEVAANSNNNNINNNNNNGLATLNQNSLNNLIQINSKINLD
SEKIEKITKILFDHPDKEWTAARNRLIEVLKDPIFECKPYASFHEQRELAQKRVAHLASI
PGGPILKVGEIVSNYKKFSMFQSTLVYCDMSMAVKSSVHWGLFGASVCCLGSEKHEKYYD
DIDTCKMSGCFALTELAHGSNVKGVETIAEYDNKTQEFVIHTPSDTAQKIWIGNAATYGC
FATVFANLISNGENYGLHPFLVQIRDTTTLKPLAGITTADNGPKIGLNGVDNGRLWFNKV
RIPRDNLLNKFGDIDANGVYSTPIKNPSVRFNSMLESLIGGRITVANMANSAAKMGLYIA
LHYAFSRRQFGPSNGKEVLLIDYITHQRRLFPQLAEVYINQVGINYVINKFQNRTEKDAR
DVFLLACGFKAATTWNRSKTLQLCRECCGGQGMAASNKIGILRADTDVDLTYEGDNTVLM
QAVAKALLQEFKSYFTGTKRITGMLSYTYSKGHIGIFLRNKNFFTKRLHTESHLLDPDVL
LDAFIYREFKLLRNLIKTLRAKVKNEKMTGLQAWNSSLDLVLQLANAYIERVSIEKFLEE
VQKSPEDIKPILTSLCILYELTKIENDLGWFLSNKYFAPVKGQAIGNTINKVCGALKDHA
IPLVKAFDIPSQFLTAPIIGDWVSHFSNPNNC
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggaaagattatcaattatttgtaatcattttgaagataatgattcattagaatcaaat
gaagttgcagcaaattctaataataataatattaataataataataataatggattagca
acattaaatcaaaattcattaaataatttaattcaaattaattcaaagattaacttggat
tcagaaaagattgaaaaaattacaaaaatattatttgaccatccagataaagaatggaca
gcagcacgtaatagattaatagaggtattgaaagatccaatctttgagtgtaaaccatat
gcgtcattccatgaacaaagagaattggcacaaaagagagtagcacatttagcatcgata
ccaggtggaccaattttaaaagttggtgaaatcgtatcaaactataagaaattttcaatg
tttcaatctacattggtctattgcgatatgtcaatggcagtgaaatcctcagtgcattgg
ggtttattcggagcatcggtatgttgtttaggttcagagaaacacgagaaatattacgac
gatatcgatacttgcaaaatgagtggctgttttgcattgacagagttggctcatggttca
aatgtgaaaggtgttgaaaccattgcagagtacgataacaagacacaagagtttgtaatt
cacacaccatcagacacagcacaaaagatttggattggtaatgctgcaacctatggttgt
tttgctacagtgtttgcaaatttaatttcaaatggcgagaattatggtttacatccattc
cttgtacaaattagagacaccacaacattgaaaccattggcaggcatcacaacagctgat
aacggaccaaagattgggttgaatggtgttgataatggtcgtttatggtttaacaaggtt
agaatcccacgtgataatcttttgaacaagtttggtgatattgatgccaatggtgtttat
agtacaccaattaagaatccaagcgttcgtttcaattcaatgttagagtcgttgattggt
ggtcgtatcactgttgcaaatatggcaaattcagcagcaaagatgggactttacattgct
ttacattatgcattctcacgtcgtcaatttggtccatccaatggtaaagaggtgttgtta
atcgattatatcacacatcaacgtcgtttattcccacaattggcagaggtttacatcaat
caagtcggtataaattatgttatcaataaattccaaaatagaactgaaaaggatgcaaga
gatgtcttcctattggcatgtggtttcaaagcagcaacaacttggaatcgttcaaaaact
ttacaactctgtcgtgaatgttgtggtggtcaaggtatggcagcaagtaataaaattggt
attcttcgtgctgataccgatgtagatttaacctacgaaggtgataacacagtactaatg
caagccgttgccaaagcattgcttcaagagtttaaatcctatttcaccggtacaaaacgt
ataactggtatgttgagttacacctattccaagggccacattggtatctttttaagaaat
aaaaactttttcaccaaacgtttacacacagaatcccatctattggatccagatgtattg
ttggatgctttcatctatcgtgaattcaaactccttcgtaacttgatcaaaactcttaga
gccaaagtaaagaatgaaaaaatgacaggtcttcaagcttggaatagtagtttggattta
gtacttcaattggcaaatgcttacattgaaagagtttccattgagaaattcttggaagaa
gttcaaaaatctccagaagatattaaaccaatcttaacttcactttgtatcctctatgaa
ttaacaaagattgaaaatgatcttggttggttcctttcaaataaatactttgcaccagtt
aaaggtcaagcaattggtaatacaatcaataaggtttgtggtgcattaaaagatcatgca
attccattagttaaagcatttgatattccatctcaatttttaactgctccaattattggt
gattgggtttctcatttttcaaatccaaataattgttaa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286669
Entry
DDB_G0286669      CDS       T00245                                 

Definition
(RefSeq) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00071  Fatty acid degradation
ddi00410  beta-Alanine metabolism
ddi00592  alpha-Linolenic acid metabolism
ddi00640  Propanoate metabolism
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01200  Carbon metabolism
ddi01212  Fatty acid metabolism
ddi04146  Peroxisome
Module
ddi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DDB_G0286669
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DDB_G0286669
   00592 alpha-Linolenic acid metabolism
    DDB_G0286669
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0286669
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0286669
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0286669
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     DDB_G0286669
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 8625750
NCBI-ProteinID: XP_637610
dictyBase: DDB_G0286669
UniProt: Q54LF1
Position
4
AA seq 667 aa
MLQFKPSNNDVQQKINDQNSKSKLSLSDKLKNWSIQGFENHNIRDELNRIMSTSEVFKVK
ELDMTKEANRVLVLKQVLEITRGVFEKGLIQISDLRDDPSKILAFIDIVSQFDDASLMTK
LIVNNFLFGAAVFNLGTERHHKLLPDIQSGRLLGCFAMTELGHGSNVRSLETTATYDPKT
DEFIIQTPYRTSTKWWIGNAGHAQISSVFARLIMDDGKDHEVHCFLVPIRKSNGVDLLPG
VKIGDVGSKFGLHGVDNGWIQFDNVRIPASNLLDRFGSVENGIYSSPIKNPSRRFANILA
QMITGRITISFGSTRTLKSGLIIATRYACKRLQFGPTSTGPEIPILSYPTHQLTIMPMIA
STYAFDAIKIYLGKRFQERTDEAEIHVLASGLKAITSQFTTVSLMELRRLCGGHGYGGYS
RLGKLVAAIDVGRTFEGDNTLLLQQVAKDLLTQFKKEYSGNKFTGTLKYLGKNTSLLLSG
MNPITTMRSDDNHLLSFQFLLDCMEFRSSKLLIQSAQTVSKNYKKSKESFTAWNQSLEIL
IHLAKAHTETIILQKFIEKIQSEKDLELASILKKLCQLYGLYIIREDFEFFRNSNYLKKG
KAKAIIKLIGQLCSDLSQQAMLLVKGFGNEEYLMNSPLGMEDGDLYENICNQVGGPFTKD
NYIQSKL
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgttacaatttaaaccatcaaataatgatgttcaacaaaaaataaatgatcaaaattca
aaaagtaaattatcattatcagataaattaaaaaattggtcaattcaaggttttgaaaat
cataatattagagatgaattaaatagaattatgtcaactagtgaagtttttaaagtaaaa
gaattggatatgacaaaagaggctaatagagtgttggtattaaaacaagttttagaaatt
actcgtggtgtttttgaaaaaggcttaatacaaatttcagatcttcgtgatgatccaagt
aaaattttagcatttattgatatagtatcacaatttgatgatgcaagtttaatgacaaaa
ttaattgtaaataattttttatttggtgccgcagtatttaatttaggaacagagagacat
cataaactattaccagatattcaatcaggaagattattaggatgttttgcaatgacagaa
ttaggacatggtagtaatgttagatcattagagactactgctacttatgatccaaagacc
gatgaatttataattcaaacaccttatagaacttcgactaaatggtggattggtaatgct
ggccatgcacagatttcatcggtatttgcaagattgataatggatgatggtaaagatcat
gaggttcattgttttttagtaccaattcgtaaatccaatggagtagatttacttccaggt
gtgaaaattggtgatgtaggctcaaagtttggtttgcatggtgttgataatggttggatt
caatttgataatgttagaattccagcatcaaatttattagatcgttttgggtctgtagag
aatggaatttactcatcaccaattaagaatccatcaagacgttttgcaaatattttagct
caaatgatcactggtagaatcaccattagttttgggtcaactcgtactttaaagtctggt
ttgataattgccacccgttatgcatgtaaaagattacaattcggaccaacctcaacagga
ccagagataccaattctttcatacccaacacatcaactcaccatcatgccaatgattgca
tctacctatgcattcgatgctattaaaatctatttgggtaagagattccaagagagaact
gatgaggcggaaatccatgtattggcatcgggtctcaaagcaatcacttcacaattcacc
actgtgtctctaatggaattgagaagattatgtggcggtcatggttatggcggctattca
cgtttgggtaaattggtggccgcaatcgatgtaggtagaacattcgagggtgataacaca
ctattgctccaacaggttgccaaggatttactcacacaattcaagaaggagtacagtgga
aacaagttcactggcacattgaaatatttgggcaaaaacaccagtctcctcctcagcggc
atgaacccaatcaccaccatgcgtagtgatgacaaccatttactctctttccaattcctt
ttggattgcatggaatttagatcttcaaaacttttaattcaatctgctcaaaccgttagt
aagaattataaaaaatcaaaagaatcattcacagcatggaatcaatctttagagatttta
attcatttggctaaagctcacactgaaactatcatccttcaaaagtttattgaaaaaatt
caatctgaaaaggatctcgaattggcttccatcctaaagaaactttgccaactctatggt
ctttacatcattagagaggatttcgaattctttagaaatagtaactacttaaagaaaggt
aaagctaaagctatcatcaaattaatcggtcaattatgttctgatctctctcaacaagct
atgcttttagttaaaggttttggtaatgaagaatacttaatgaattcacctttaggtatg
gaggatggtgatctctatgaaaatatttgtaaccaagttggtggtcctttcactaaagat
aattatattcaatctaaattgtaa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288735
Entry
DDB_G0288735      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00071  Fatty acid degradation
ddi00410  beta-Alanine metabolism
ddi00592  alpha-Linolenic acid metabolism
ddi00640  Propanoate metabolism
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01200  Carbon metabolism
ddi01212  Fatty acid metabolism
ddi04146  Peroxisome
Module
ddi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DDB_G0288735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DDB_G0288735
   00592 alpha-Linolenic acid metabolism
    DDB_G0288735
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0288735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0288735
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0288735
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     DDB_G0288735
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_ox_N Acyl-CoA_dh_1 Acyl-CoA_dh_N
Other DBs
NCBI-GeneID: 8626781
NCBI-ProteinID: XP_636605
dictyBase: DDB_G0288735
UniProt: Q54II1
Position
5
AA seq 652 aa
MESYEERVRNIVNHLTPPKEILMNDCLSSEEEILNINNTSSTTTSTLTWNKQELSEYLEA
APDHIKVAKKKLQEIVKDPIFLPKYNMNVQQWRELTLQRAMIIIKAGAISLAEFNRDPMK
YLVSMEMLNLVDPSLSVKLGVHFSLFGNAVLNLGTEKHHIKYIKDIDSWKLPGCFGMTEL
GHGSNVQGVETTATYDKTTQEFIINTPSDSAQKFWIGNAACHGQACSVFAQLYIDNVHYG
VHVFVVPIRNSDGTIAENVRIMDNGHKLGLQGVDNGRIWFDNKRIPRDNLLNKFGDVEAD
GTYVSSIPSKSKRFGSMVAPLVGGRVLIAASALNVSKMALMIATRYAYSRKQFGSKGNEI
RIIEYLTHQRRLFPMIATSVALSFAVEKLKKIYCEPNKTSQNVKDLHVWSSGLKAVVSWT
KTNILQLTRECCGGQGFSSFNQIALFKSDLEIDMTYEGDNHVLLQQVARNLLVELQKGRY
TLTSPNHDSAHIYDYDFQIQTLKWRESDLVSTLSSKIMSQLDQGLSLEQGWNTCLDTITL
LGKAFVDRITLEEFQSGINNAPSSLKQVLELCRNLFFSWKVNEDLGYFLCNDGLATPAAL
KIQGSINKLCSDMLPIGLDLVNSFNIPEQFIHAPISKPDYIQEFRYGLKRDY
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggaatcatatgaagaaagagttagaaatattgtaaatcatttaacaccaccaaaagag
attttaatgaatgattgtttatcatcagaggaagagattttaaatattaataatacttca
tcaacaactacaagtacattaacatggaataaacaagagttatcagaatatttagaagca
gcaccagatcatattaaagttgcaaaaaagaaattacaagaaatagttaaagatccaatt
ttcttaccaaaatataatatgaacgttcaacaatggagagaattaacattacaaagagca
atgatcatcattaaagcaggtgctatttcattggcagagttcaatcgtgatccaatgaaa
tatttagtttcaatggaaatgttaaatttggtagacccatcgctatctgttaaattgggt
gttcacttttcattatttggtaatgcagttttaaatttaggtacagagaaacatcatatc
aaatatattaaagatattgatagttggaaattaccaggttgttttggtatgacagaattg
ggtcatggctcaaatgttcaaggcgttgaaaccaccgctacctatgataaaaccacccaa
gaattcattataaatacaccatcggattcagctcaaaagttttggattggtaatgccgca
tgtcatggtcaagcatgttcagtgtttgctcaattgtatattgataatgtacactatgga
gtacacgttttcgttgtaccaattcgtaattccgatggtaccatagcagagaatgttaga
atcatggataatggtcataagttaggtttacaaggtgttgataacggtagaatttggttt
gacaataaacgtattccaagagataaccttttaaacaaatttggtgatgttgaagccgac
ggtacctacgtctcttccatcccatcaaagagtaagagattcggttcaatggttgcacca
ttggttggtggtagagttttaattgccgcttccgctttgaatgtctcaaagatggcattg
atgattgcaactcgttatgcatatagtagaaaacaatttggttcaaaaggtaatgaaatt
cgtatcattgaatatttaactcatcaacgtagattattcccaatgattgccaccagtgta
gctctttcattcgcagttgaaaaattaaagaaaatctattgtgaaccaaataaaacctca
caaaatgtaaaggatctccatgtttggtcctctggtttgaaggctgtagttagttggaca
aaaacaaacattcttcaattgactagagaatgttgtggtggtcaaggtttctcatcattc
aatcaaatcgcattgtttaaatcggatttagagatcgatatgacctatgaaggtgataat
catgtactccttcaacaagttgctcgtaaccttttggtagagttacaaaagggtcgttac
acattgaccagtccaaatcatgactctgcacacatttacgattatgatttccaaattcaa
accttgaaatggagagaaagtgatttagtctcaactttatcctcaaagattatgtctcaa
ctcgatcaaggtctttcattagaacaaggttggaatacctgtttagataccatcacctta
ttgggtaaagctttcgttgatcgtatcactttagaggaattccaatctggtatcaacaat
gctccttcctctttaaaacaagtcttggaactttgtagaaacttattcttttcttggaaa
gttaatgaagatcttggttacttcctttgtaatgatggtcttgcaactcctgctgcactt
aaaattcaaggttctatcaataaactttgttctgatatgttaccaattggtttagacctt
gtaaattctttcaatatccccgaacaattcattcatgccccaatctcaaaaccagattat
attcaagaatttagatatggtttaaaaagagattattaa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289993
Entry
DDB_G0289993      CDS       T00245                                 

Definition
(RefSeq) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00071  Fatty acid degradation
ddi00410  beta-Alanine metabolism
ddi00592  alpha-Linolenic acid metabolism
ddi00640  Propanoate metabolism
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01200  Carbon metabolism
ddi01212  Fatty acid metabolism
ddi04146  Peroxisome
Module
ddi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DDB_G0289993
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DDB_G0289993
   00592 alpha-Linolenic acid metabolism
    DDB_G0289993
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0289993
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0289993
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0289993
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     DDB_G0289993
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M
Other DBs
NCBI-GeneID: 8627428
NCBI-ProteinID: XP_635946
dictyBase: DDB_G0289993
UniProt: Q54GQ6
Position
5
AA seq 700 aa
MYCPKAYENEKKNEDLEFERSQSTFSVSELNFILNNNDHNIINIKNEIKKFIDNDEIISK
PQEIHFLSREEQYKRALYVSSKLIEIKKRFGEIGRDQYYQSLFEEIPFVINDIVFACAFK
SLASDEQMNRLYSKFENYQYFGSYSQTEIGHGSNVQGIETTCTFIKETGEFELNSPNLTS
TKFWIGGLGKLATHTIVFAQLLIPSSIDGKLKNYGPHPFILQVRSLDDHSPLPGVTVGDI
GPKLGFNSIDNGFLRLDHVRIPRENMLSRFFRVNEQGEYEKPKHPKLIYAGMVGVRSSMI
ENSFVSLSRAVTIAIRYSTIRKQFKSNRLDKQEKKIIEYSNQMNRIIPYLAQTFAYFFTG
KRFSIEFDQMMKAVKHNQDTTLLSELHANSSGLKSLMTQSTSDGIESCRLSCGGHGYSQF
SGLPYLWSNYVHMSSAEGESNLLPQQTTKYLLTILRKVLSGGGGSSDTTTADDDNKPIGK
SVKYINDEFQSSFENINQFIQEKGLNSIIHPDSLLQLFKHRSFILIKSIAESIQEQMSNG
NKDIPQIWSDLNVEINHCSKAHCQLYVIQSFYDQILLLSSNSSSCSSSITTVLIQLLQTY
SIWIINSNLVDFLQDQYVELSQIDFLKKSLINFYKLLRPNLVPLVDSFDLCNTTLGSALG
SYNGDVYSTLYKWASTQPFNKNSLPLGFNETIKPLINSKL
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgtattgtccaaaagcatatgaaaatgaaaaaaaaaatgaagatttagaatttgaaaga
agtcaatcaacattttcagtttcagaattaaattttattttaaataataatgatcataat
attataaatattaaaaatgaaattaaaaaatttattgataatgatgaaattatttcaaaa
ccacaagaaattcattttttatcaagagaagaacaatataagagagcattatatgtttca
tcaaagttaattgaaataaagaaaagatttggtgagattggtcgtgatcaatattatcaa
tcattatttgaagagataccattcgttattaatgatattgtatttgcatgtgcatttaaa
tcattagcaagtgatgaacaaatgaatagattatattcaaaatttgaaaattatcaatat
tttggatcatattcacaaacagagattggtcatggttcaaatgttcaaggaattgaaact
acttgtacttttattaaagaaactggcgaatttgaattaaattcaccaaatttgacatca
actaaattttggattggtggtttaggtaaacttgcaactcatactattgtttttgctcaa
ttattaattccatcaagtattgatggtaaattaaaaaattatggaccacacccattcatt
ttacaagttagaagtttagatgaccattcaccattgccaggtgtcaccgttggtgatatt
ggcccaaagttaggattcaattcaattgataatggatttttaagattggaccatgttaga
ataccacgtgaaaatatgttatcaagattctttagagtgaatgaacaaggcgaatatgag
aaaccaaaacatccaaaattgatctatgctggtatggttggtgttagatctagcatgatt
gagaattcattcgtaagtttatcacgtgctgttacaattgcaattcgttattctacaatt
agaaaacaatttaaatcaaatcgtttagataaacaagagaagaaaatcattgaatattca
aatcaaatgaatcgtatcataccttatttagctcaaacttttgcttactttttcactgga
aaacgattttcaattgaatttgatcaaatgatgaaagctgtaaaacataatcaagatact
acacttctctcagagttacatgcaaattcaagtggtttaaaaagtttaatgactcaatca
acttctgatggtattgaaagttgtcgtttatcatgtggtggtcatggttatagtcaattt
agtggtttaccttatctttggtcaaattatgttcatatgagctctgctgaaggtgaaagt
aatctattaccacaacaaactacaaaatatttattaactattttacgtaaagttttatct
ggtggtggtggtagttctgacaccaccactgctgatgatgacaataaaccaattggtaaa
tcagttaaatatataaatgatgaatttcaatcatcatttgaaaatataaatcaattcatt
caagagaaaggtttaaattcaataattcatccagattcattattacaactttttaaacat
cgttcattcattttaatcaaatcaattgctgaatcaattcaagagcaaatgagtaatgga
aataaagatataccacaaatttggagtgatcttaatgttgaaattaatcattgtagtaaa
gctcattgtcaattatatgtaattcaatcattttatgatcaaattttattattatcttca
aattcttcaagttgttcttcatcgataaccactgttttaatacaattacttcaaacttat
agtatttggattattaattcaaatttagttgatttccttcaagatcaatatgttgaacta
tctcaaattgatttcttaaaaaagagtttaatcaatttctataaattattacgtccaaat
ttagtaccactagttgattcatttgatctctgtaatactactttaggtagtgctttaggt
tcttataatggtgatgtttattcaactctttataaatgggcttcaactcaaccatttaat
aaaaattctttaccattaggttttaatgaaactattaaaccattaataaatagtaaactt
taa

DBGET integrated database retrieval system