KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0271050
Entry
DDB_G0271050      CDS       T00245                                 

Gene name
magA
Definition
(RefSeq) DNA-3-methyladenine glycosylase I
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DDB_G0271050 (magA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0271050 (magA)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     DDB_G0271050 (magA)
DNA repair and recombination proteins [BR:ddi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DDB_G0271050 (magA)
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-GeneID: 8617613
NCBI-ProteinID: XP_001134476
dictyBase: DDB_G0271050
UniProt: Q1ZXP8
Position
1
AA seq 290 aa
MFKYPFTTFKHLFSIPTSNNYIMSSTARIITRQRSTTTTTTPIIVNSPVVKKKTTNIKNN
KIKNKKVEEGGEDLLKAPIEKKGFKPLDSKKRCFWISLTKDEEYIHYHDNEWGKENRDSQ
RLFEKICLEAQQAGLSWITVLKKRQNYRDSFYNFDPKLIVDNITPEVIENSLMKNTGLIR
NRLKLQAIVDNARAYLKMRDQDKIEFSTFIWSFVNNKSSIGQRVTGDTSVQGSRPLTRNE
VSDAMSVALKKKGFKFIGTTTLYAFMQSVGIINDHCKDCEFNPINQKKNI
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtttaaatatccttttacaacctttaaacatttattttcaataccaacttcaaataat
tatattatgtcatcaacagctagaattatcactagacaaagatcaactaccaccactact
accccaataatagtaaattctccagtagtcaaaaaaaaaacaacaaatataaaaaataat
aaaattaaaaataaaaaagtagaagagggaggtgaagatttattaaaagcaccaattgaa
aaaaaaggatttaaaccattagatagtaaaaagagatgtttttggataagtttaactaaa
gatgaagagtatattcattatcatgataatgaatggggtaaagagaatcgtgattctcaa
agattatttgaaaagatttgtttagaggctcaacaagctggtttatcgtggataactgta
ttgaaaaagagacaaaactatagagatagtttctataatttcgatccgaaattaattgtt
gataatattacaccagaggtaattgaaaacagtctaatgaaaaacacaggtttaatcaga
aaccgtttaaagttacaagcaatagttgataatgcaagagcttatttaaagatgcgtgat
caagataaaattgaattctcaacattcatttggtcatttgttaataataaatcttcaatt
ggtcaaagagtgaccggtgatacaagtgttcaaggtagtagaccattaactagaaatgaa
gtttccgatgctatgtctgttgctttaaaaaaaaaaggcttcaaattcattggtacaacc
accctttatgcttttatgcaatcagttggtatcattaatgatcattgcaaagattgtgaa
tttaatccaataaatcaaaaaaaaaatatataa

DBGET integrated database retrieval system