KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0272222
Entry
DDB_G0272222      CDS       T00245                                 

Gene name
ybl1
Definition
(RefSeq) DNA polymerase epsilon p17 subunit 3
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0272222 (ybl1)
   03410 Base excision repair
    DDB_G0272222 (ybl1)
   03420 Nucleotide excision repair
    DDB_G0272222 (ybl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0272222 (ybl1)
   03036 Chromosome and associated proteins [BR:ddi03036]
    DDB_G0272222 (ybl1)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0272222 (ybl1)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DDB_G0272222 (ybl1)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    DDB_G0272222 (ybl1)
Chromosome and associated proteins [BR:ddi03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    DDB_G0272222 (ybl1)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      DDB_G0272222 (ybl1)
SSDB
Motif
Pfam: CBFD_NFYB_HMF DUF4770 Bromo_TP CENP-S CIS_TMP Snu56_snRNP DUF913 Histone Sporozoite_P67 Vfa1 DUF6080 Atrophin-1
Other DBs
NCBI-GeneID: 8618464
NCBI-ProteinID: XP_645298
dictyBase: DDB_G0272222
UniProt: Q75JQ9
Position
2
AA seq 138 aa
MSESQDLPGAIVNRIIKASLPEGVLCAKESRLAIAKAAKVWIHYLTAASIDFSSHSGRST
ISPKDVFQAIEEIDFENFKPQLEEYLAALKSEKEKEKEKEKEKEKEKEKEKDSNKDDTKS
KDENKSSKKSSSSSKDEK
NT seq 417 nt   +upstreamnt  +downstreamnt
atgtcagaaagccaagatttaccaggtgcaattgtaaatagaattattaaagcttcttta
ccagaaggggtattatgtgccaaagaatctaggctagctattgcaaaagcagcaaaagtt
tggattcattatcttacagcagcaagtatagattttagttcacattctggtagatctaca
atatcaccaaaggatgtatttcaagcaatagaagaaatagattttgaaaattttaaacca
caattagaggaatatttagcagcactcaaaagtgaaaaagaaaaagaaaaggaaaaagag
aaagagaaagaaaaagaaaaagaaaaagaaaaagatagcaataaagatgacacaaaatca
aaagatgaaaataaatcttcaaaaaaatcctcttcctcctcaaaagatgaaaaataa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0272740
Entry
DDB_G0272740      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K03506  DNA polymerase epsilon subunit 4 [EC:2.7.7.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0272740
   03410 Base excision repair
    DDB_G0272740
   03420 Nucleotide excision repair
    DDB_G0272740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0272740
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0272740
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DDB_G0272740
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    DDB_G0272740
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      DDB_G0272740
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CDC45 Nop14 SDA1 Merozoite_SPAM DUF4666 Drc1-Sld2 Presenilin Mpp10 Zip SpoIIIAH DUF2052 Tim54 Raftlin DDHD
Other DBs
NCBI-GeneID: 8618662
NCBI-ProteinID: XP_644985
dictyBase: DDB_G0272740
UniProt: Q7KWN0
Position
2
AA seq 158 aa
MVKDDNMKDIEDDHEDEHEEEEEHEEEEEHEDEHEEEEEEHEEEDGGEKTKSKNKDKDNT
NDEKKKSKRRTRVEGDIQLPVARIKRIMRCDKDVKIISSDAVMLVAKSTEMFLDYLVKEA
YKSSGKKKTLQYKDLASTIKGVDNLDFLSEIIPEKVSI
NT seq 477 nt   +upstreamnt  +downstreamnt
atggttaaagatgataatatgaaagatattgaagatgatcatgaagatgaacatgaagaa
gaggaagaacatgaagaagaggaagaacatgaagatgagcatgaggaagaggaagaagaa
catgaagaagaggatggtggagaaaaaactaaaagtaaaaataaagataaagataataca
aatgatgaaaaaaagaaatcaaaaagacgtacacgtgttgaaggtgatattcaattacca
gttgcaagaattaaaagaataatgagatgtgataaagatgttaaaataatttcttctgat
gctgttatgttagttgcaaaatcgactgaaatgtttttagattatttagtcaaagaagca
tataaatcaagtggcaaaaagaagactttacaatataaagatttagcttcaacaattaaa
ggtgtagataatttagactttttatcagagattatacctgaaaaagtttcaatataa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0278367
Entry
DDB_G0278367      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0278367
   03410 Base excision repair
    DDB_G0278367
   03420 Nucleotide excision repair
    DDB_G0278367
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0278367
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0278367
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DDB_G0278367
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    DDB_G0278367
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      DDB_G0278367
SSDB
Motif
Pfam: DNA_pol_E_B Dpoe2NT BSP_II
Other DBs
NCBI-GeneID: 8621523
NCBI-ProteinID: XP_642317
dictyBase: DDB_G0278367
UniProt: Q54Y85
Position
3
AA seq 676 aa
MDIQWKKQITKSFSLTGFSIKADAMKCIINRIKNEGYDITQLIDNLLKNLDKSQYLQTIE
GCFKLIDTINSSDAIEKEALKVIDAFNTPLFNFDSNSKQFIKSENFDRSLHGSSNSKSDL
YRKRYLKVLQRTERNDYFSTPVLASDKLKNEYQTITPLSSLLGNTGRKHVLGTISQIEED
QFYIEDLNTNVKIDISKAKFEFGIVTINSIIQASGEFIDGVFIADKIQLPPTEERCETLK
FLQNIDMFGERPQKKTMEQLIKYEKEKEDNSILFLSDVWLDSERVMERLDYLFGGYKDCP
PFAMILMGNFTEHPLINGTQYQLKKYFNQLAMVIQKYPNIHQFTQFIFVPGPTDPTGSLL
NILPKFPISNVFIKDFISLIPKSTFTTNPCRIRYCSQEIIIFRDDLTNKMRRHCILEPSQ
SCDISQHLIELICSNSHLCNLTLEDKPIYWNYDHAMSVYPLPDLLVIGDKSNQYEHSRAD
GTYSMNPSSFSTDYSFAHYIPANKQFYYNKADRPSDEIEDDDDDEEVENQNENENENENE
NENENENENNDNDKTQQKDTQGDGDDNDDDEIMIDENEKQKSRKRNKKVVIITKEDELNK
LEDDEEILNSLDVQQQSENHADNNNNNINNNNNDDDNEDDEDSNYNNIESEVQEVEKEEE
EDEEPIDNDKLDEFIE
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggatatacaatggaagaagcaaattactaaatcattttcattaactggtttttcaatt
aaagcagatgcaatgaaatgtattattaatagaataaagaatgaaggttatgatataact
caattaattgataatttattaaaaaatttagataaaagtcaatatttacaaacaattgaa
ggatgttttaaattaattgatacaattaatagttcagatgcaattgaaaaagaagcatta
aaagtaattgatgcatttaatacaccattatttaattttgattcaaattcaaaacaattt
ataaaaagtgaaaattttgatagatcattacatggatcatcaaattcgaaatcagattta
tatagaaaaagatatttaaaagttttacaaagaactgaaagaaatgattatttttcaaca
ccagttttagcatctgataaattaaagaatgaatatcaaactattacaccactaagttca
ttacttggtaatactggtagaaaacatgtacttggtacaatatcacaaattgaagaggat
caattctatatagaagatttaaatacaaatgttaaaattgatatttcaaaagctaaattc
gaatttggtatagtcactataaattcaatcattcaagcatctggtgaatttattgatggt
gttttcattgctgataaaattcaattaccaccaactgaagaaagatgtgaaacattaaaa
tttttacaaaatattgatatgtttggagaaagaccacaaaaaaagacgatggaacaattg
ataaagtatgaaaaagagaaagaggataattcaatattatttctatcagatgtttggtta
gattcggaaagggttatggaaagattagattatttatttggtggttataaagattgtcca
ccatttgcaatgatattgatgggtaatttcactgagcatcctttgatcaatggtacacaa
tatcaattgaaaaagtattttaatcaacttgcaatggtaattcaaaagtatccaaatata
catcaattcactcaattcattttcgtacctggtccaactgacccaactggttccttatta
aatattttaccaaagttcccaatttcaaatgttttcataaaggatttcatttctttaatt
ccaaaatcaacctttacaactaatccatgtagaattagatactgttctcaagaaattata
atatttagagatgatttaacaaataaaatgagaagacattgtattttagaaccttcacaa
tcatgtgatatttctcaacatttaattgaattaatttgtagtaattcacatttatgtaat
ttaacattagaagataaaccaatttattggaattatgatcatgcaatgtctgtttatcca
ttaccagatttattggtaattggtgataaatcaaatcaatatgagcattcacgtgctgat
ggtacttattcaatgaatccaagttctttctcaacagattattcatttgcacattatatt
ccagcaaataaacaattttattataataaagctgatagaccaagtgatgaaattgaagat
gatgatgatgatgaagaggtggaaaatcaaaatgaaaatgaaaatgaaaatgaaaatgaa
aatgaaaatgaaaatgaaaatgaaaataatgacaatgataaaacacaacaaaaagatact
caaggtgatggtgatgataatgatgatgatgaaattatgattgatgaaaatgaaaaacaa
aaaagtagaaaacgtaataaaaaagttgtaatcattaccaaagaggatgaattaaataaa
ttggaagatgatgaagaaattttaaatagtttagatgttcaacaacaaagtgaaaatcat
gctgataataataataataatattaataataataataatgatgatgacaatgaagatgat
gaagattcaaattataataatattgaatctgaagttcaagaagttgagaaagaagaagaa
gaagatgaagagcctatcgacaacgataagttggatgaattcattgaataa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283189
Entry
DDB_G0283189      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0283189
   03410 Base excision repair
    DDB_G0283189
   03420 Nucleotide excision repair
    DDB_G0283189
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0283189
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0283189
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DDB_G0283189
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    DDB_G0283189
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      DDB_G0283189
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2
Other DBs
NCBI-GeneID: 8623984
NCBI-ProteinID: XP_639211
dictyBase: DDB_G0283189
UniProt: Q54RD4
Position
4
AA seq 2380 aa
MSQKWNENKKNKDEKDENDKYVGFKNYEKEGWLLNMQPGSSKDGLDIEKASLELFFIQDD
ATSFRVWIPYNPYFYIYVKEGHQSEVESYLKSTYEKDIAGIDIMDKEDLDLENHLSGLKR
KYLKIRFHNVSTLLSVRNDLFPIIKRNKQKSNTSEAYEDESLNKILNSYYNKGNNNNNNH
QNYNNNNNQNNNNFNKELNKDDNNNNNSKLNKQATEYILDIREYDVPYYVRAAIDLNIRV
GLWYTVIKNGRLTTVNELTTRVDRPDPKVLAYDIETTKLPLKFPDSSIDSIMMISYMLDK
QGYLIVNREIVSEDIKDFEYTPKPEYYGPFTVFNEPDEKSVLERFFSEIKREKPHIFVSY
NGDMFDWPFVESRAEYHGLSMFHQIGFRNDNGEYRSKINPHMDAFCWVKRDSYLPHGSHG
LKAVTREKLRYDPLELDPELMLKSAQEDPETLANYSVSDAVATYYLYMNYVHPFIFSLCT
IIPMNPDDVLRKGSGTLCEALLMTQAFKADVIFPNKHKDDINSMYKGHLLESETYVGGHV
ECLESGVFRSDIPTNFSLDPASIEKHMGNIDQVLKFALKEGGIPLDTVSNYQEVKEDVLK
KFTLLKENPKQQSHPLIYHLDVSAMYPNIILTNKLQPTAVVNDEVCATCVYNKPESQCQR
TLDWQWRGDYSPSNQSEYRLILQQLESEKFGDGDERKSFLSLSEEKRNELLRKRLKEYSR
KVYRKTHQITQEIRSDTICMRENSFYVDTVRLFRDRRYVFKNHHRDWKIKYDQAMQESGG
TNSVAVVAAQGMVVLYESLQLAHKCILNSFYGYVMRKGARWYSMQMAGIVTHTGSNIIKE
AREVVEQMGRPLEIDTDGIWCILPSHFPENYTLKSASTGKKVTFSYICEMLNEKVAKSFT
NHQYQDYNAETNTYTIRDECSILFECDGPYRCMLIPTSKEKDVKLKKRYAVFNREGRICE
LKGFEIKRRGELKLIKLFQSEVFKEFLGGDSLEGCYQSVGAVANRWLDILDSHAENYEEK
DLIELITESSNMSRKLEEYGTQKSSAISTAKKLAEFLGDDMIKDKGLSCQYIISNKPAGS
PITERALPVAIFDADFETRCHYLRRWTKSPSGDLDIRELIDWDYYRQRLSGVIQKIITIP
AALQNVTNPVPRVIHPDWILKEIRRNEDGRQQTSITSFFEKTEDNDQDNDNDNDNDNDND
NDNSKPQQTDDIENMFSSRFKDLPAFNPKVTKFKRSKQSSSDVSSLLIKKSKSSIETFTN
EQEKQIMETKTPSIDKDFQGWLSISKKKWKIQRLLKKRRQRLGGSLFDSDSFRIGSKLTN
RESSSSSFFKSQSDIIKKGYWNIISIEPIYGGEPGIYQMWSLIEDQLIPIKVDIGRVFYL
NSIDTDPYEDAQKNTNVIPPRGKQRFNVFSVTMSESQFLEQSKELNTLFTNPMIEGVYET
KVPLDIKAIIQCGCVATLSRVSPFFTKIVNSNTRFSLEDIASKPDKQFHYLAEHNFNQLF
LYHNSRDGKDGYFVLFNMNTQQCSVIFSNPYMAANKIDARVLNSIKEKLPEITFTMDQKS
SMSLAKKEIGSLIMEYQRKGLPTIILLQVPNAIGILEQIPILREFPRVPVPYHDNDSMYS
PFNWDVHSLKPLPLRLMDAPKLWVYYANMSRYANIPIGNIPTDNASFMCDILYARSLVEQ
KHLLWMSDSNFPDLGGSEEDDAKFYEELNNVEINNSDCYNQVCFELDIENLATNTILESI
HLAEIEGILGNELGDESNVAMFDDIKNTSNNSNTKNGANQNTTNDTTSSFDKLSITNKFR
SAINHQISGCEKEFNILRNLVSKWKLDLVSGSNSKRNEISSRYSNYLLLHFYRWISSTNS
KLYDPILYRTLHQLMKKVFIQLIFEFKKLGSKIVYANFNKIIICSQKDSIEDARSYCNYI
LAVIKKKELFSWINFKQTNYYHNLLWLNNSNYSGILYFNPLINKNQQQQQQQQDNADDDD
DDDVSENEEEQQQNKNKKLKKIKNGKIITNWNIAEFLPPQIQTSFIIIISDYIYKLHTER
DELNRIQKEQQQRYLLKQKISTTSSSSNNDSTAATTTTTKDTINEPTKPDLRKSSTWNEE
EDEDISIPPSSSSSTTTTTSKTKKATSKFDLLIDVNRIFTLLDHFQVNQSSLEFPQLPGG
YLKLNNPPLEFIKFVCHVLSIDKSISSRVSRLRMKLMTSMKVREFSDEAKFKDPCVSFTL
PDVICSSCHSCRDIDLLRNTNTTSISSRLSSQQKSNNNDSDDSDDDNEENEGDDDNIIRV
PELSCIQCKGHYSKNTIESQLVEIIQRRSLSYQLQDLRCSKCNDVKSDNLGDICPQCSGQ
WECTQSNNLFSKDLIIFKSIAEYHNFEWLGETVDSLSKFI
NT seq 7143 nt   +upstreamnt  +downstreamnt
atgtctcaaaaatggaatgaaaataaaaaaaataaagatgaaaaagatgaaaacgataaa
tatgttggtttcaaaaattatgaaaaggagggttggttattaaatatgcaacctggatca
tcaaaagatggacttgatattgaaaaagcttcattagaattattttttattcaagatgat
gcaacatcatttagagtatggataccttataatccatatttttatatttatgtaaaggaa
ggtcatcaatcagaagtagaatcatatttaaagagtacctatgaaaaagatatagcaggt
attgatattatggataaagaggatttagatttagagaatcatttatcaggtttaaaaaga
aaatatttaaaaattcgttttcataacgtttcaacacttttatcagttcgtaatgattta
ttcccaatcattaaaagaaataaacaaaaatcaaatacaagtgaagcatatgaagatgaa
tcattaaataaaattttaaattcatattataataaaggaaataataataataataatcat
caaaattataataataataataatcaaaataataataattttaataaagaattaaataaa
gatgataataataataataatagtaaattaaataaacaagcaactgaatatatattagat
attagagaatatgatgtaccatattatgttagagcagcaattgatttaaatattcgtgtt
gggttatggtatacagttataaagaatggtagattgacaacagtgaatgaattaacgact
cgtgttgatagacctgatccaaaagtgttggcatatgatattgaaactactaagctacct
ttgaaatttccagattcttcaattgattcaattatgatgatctcttatatgttggataaa
caaggttatttaattgtaaatcgtgaaatcgtgtctgaggatatcaaagatttcgaatat
actccaaagcctgaatattatggcccattcaccgtttttaatgaacccgatgagaaatca
gtattggagaggtttttcagtgaaattaaaagagagaaaccccatatattcgtatcgtac
aatggtgatatgtttgattggccttttgttgaaagtagagcagagtatcatggtttgagt
atgtttcatcagattggatttagaaatgataatggcgagtatagaagtaagatcaaccct
catatggatgcattttgctgggtgaagagagacagttatcttccacatggcagtcacggt
ttgaaagcggtcacaagagaaaagttaagatacgatccattagagttggatccagagtta
atgttaaaatctgctcaagaggatcctgaaactttagcaaattactcagtttccgatgca
gttgcaacttattatctctatatgaattatgttcatccattcattttctcactttgtaca
attattccaatgaatccagacgatgtgcttagaaaaggttcaggtacattatgtgaagcc
ttgttaatgactcaagcttttaaagctgatgtaatatttccaaataaacataaggatgat
attaatagtatgtataagggtcatttattagagagcgagacttatgtgggtggtcatgta
gagtgtttagagtctggtgtattcagatcagatattccaactaatttctcattagaccct
gcttcaattgaaaagcatatgggtaacattgatcaagttttgaagtttgcattgaaggag
ggcggcattccattagataccgttagtaattatcaagaagtgaaagaagacgtattaaag
aaattcacattgttaaaagagaatccaaaacaacaatcacatccattaatttaccatctt
gatgtgtctgctatgtatcccaatattattctcaccaataaacttcaaccaactgcagtg
gtcaatgacgaggtttgtgccacttgtgtctacaataaaccagagtctcaatgtcaacgt
actctcgactggcaatggaggggtgactattcaccatcgaatcagtcagagtatcgttta
attctacaacaattggaatctgagaaatttggtgatggagatgaaagaaaatcattctta
tcactaagtgaagagaaacgtaatgaattattaagaaaacgtttaaaagagtactctaga
aaagtctatagaaaaacccatcaaatcacacaagaaattcgttccgacactatttgtatg
cgtgaaaattcattctacgtcgatactgtacgtctattccgtgatcgtcgttatgttttc
aagaatcatcatcgtgattggaagataaagtatgatcaagcaatgcaagaatctggtggt
accaatagtgttgctgtggtagctgcacaaggtatggttgtactctatgaaagtcttcaa
ttagctcacaagtgtattctaaactctttctatggttatgtaatgagaaaaggtgctcgt
tggtattctatgcaaatggcaggtattgtaacacatacaggttcaaacatcattaaagaa
gcaagagaagtggtagagcaaatgggtagaccattagagattgataccgatggtatttgg
tgtatacttccatcacatttcccagagaattacacattaaaatcagccagtactggtaaa
aaagttactttttcttacatttgcgaaatgttgaatgaaaaagttgcaaaaagtttcaca
aatcatcaataccaagattacaatgctgaaaccaacacttatacaattcgtgacgaatgt
tccattctattcgaatgtgatggtccttatcgttgtatgttaattccaactagtaaagag
aaagatgtgaaattaaagaaacgttacgctgtattcaatcgtgaaggtcgtatttgtgaa
ttaaaaggtttcgaaattaaaagacgtggtgaattgaaattgattaaacttttccaatct
gaagtgtttaaagaatttttaggtggtgatagtttggaaggctgttatcagtcggttggt
gccgttgcaaatcgttggttagacattctagatagtcatgctgaaaactatgaagaaaag
gatctaatagaactaattaccgaaagtagtaatatgagtagaaaattagaagaatatggt
acacaaaagagttcagctattagtactgccaaaaagttagcagagtttttaggtgacgat
atgatcaaggataaaggtttatcatgtcaatacattatctccaataaaccagccggttca
ccaattactgaacgtgctttaccagttgcaatttttgatgcagattttgaaactcgttgt
cattatcttagaagatggacaaaatctccaagtggtgatttagatattcgtgaattaatc
gattgggattattatcgtcaacgtttatctggtgtaattcaaaaaattattacaattcct
gctgcacttcaaaatgttacaaatccagtaccacgtgttattcatccagattggatttta
aaagaaattagaagaaatgaagatggtcgtcaacaaacttcaattacttcattttttgaa
aaaactgaagataatgatcaagacaatgataatgataatgataatgataacgataatgat
aatgataattcgaaaccacaacaaactgatgatattgaaaatatgttttcatcaagattt
aaagatttaccagcatttaatccaaaagttactaaatttaaaagaagtaaacaatcatca
agtgatgtttcaagtcttttaattaaaaaatcaaaatcatcaattgaaacatttacaaat
gaacaagaaaaacaaattatggaaactaaaacaccatctattgataaagatttccaaggt
tggttatcaatatcaaaaaagaaatggaaaattcaacgtttattaaaaaagagaagacaa
agattaggtggatcattatttgatagtgatagttttagaattggttcaaaattaacaaat
agagaaagttcatcatcgtcattctttaagagtcaatcagatataattaaaaaaggatat
tggaatattatatcgattgaaccaatttatggcggtgaaccaggtatttatcaaatgtgg
tcattgattgaggatcaattgataccaattaaagttgacattggtagagtgttttattta
aattcaattgataccgatccatatgaagatgcacaaaagaatacaaatgtaataccacca
agaggtaaacaaagatttaatgttttttcagtgacaatgagtgaaagtcaatttttagaa
caatcaaaggaattgaatacactattcaccaatccaatgattgagggtgtctatgaaaca
aaggtaccattggatattaaagccattattcaatgtggttgtgtagctactttgtcaaga
gtatcaccattctttactaaaatagtcaatagtaacacaagattctctttggaggatatc
gcttcaaaacctgataaacaatttcattatcttgcagaacataactttaatcaactcttt
ttgtatcataatagtcgtgatggaaaagacggttatttcgttcttttcaatatgaatact
caacaatgttcagttattttctcaaatccttatatggccgccaacaaaatcgatgcaaga
gtattgaattccataaaggagaaactaccagaaatcacctttacaatggaccaaaaatca
agtatgtctttggcaaaaaaagaaattggttcattaattatggaatatcaacgtaaaggt
ttaccaactatcattctactacaagttccaaatgcaattggaatattggaacaaattcca
atacttagagaattcccacgtgtaccagtaccttaccatgacaacgattcaatgtattca
ccattcaattgggatgttcattcattgaaacccttaccattacgtttaatggatgcacca
aaactttgggtttactatgcaaatatgtcacgttatgcaaatatacccattggtaatatt
ccaactgataatgcatcattcatgtgtgatattctctatgctcgttctttggttgaacaa
aaacatctcctttggatgtctgattcaaacttcccagatttaggtggttcagaagaagat
gatgcaaaattctatgaagaattaaataatgttgaaattaataattcagattgttataat
caagtttgtttcgaattggatattgaaaatttagcaacaaatacaatcttggaatcaatt
catttggctgaaattgaaggtattttaggtaatgaattaggtgatgaatcaaatgttgca
atgtttgatgatattaaaaatacttcaaataattccaataccaaaaatggtgcaaatcaa
aatactacaaatgatacaacatcatcatttgataaattatcaattacaaataaatttaga
tcagcaattaatcatcaaattagtggttgtgaaaaagaatttaatattcttagaaattta
gtatcaaaatggaaattggatttagtatcaggtagtaatagtaaaagaaatgaaattagt
tcacgttattcaaattatcttttattacatttctatcgttggattagctcgaccaattca
aaactttatgatcctatcctttatcgtactttacatcaattaatgaaaaaagttttcatt
caattgattttcgaatttaaaaaattgggtagtaaaatagtttatgcaaatttcaataag
attatcatttgttctcaaaaggattcaattgaagatgctcgttcttattgtaactatatc
ttggctgtaattaaaaagaaagaattatttagttggattaattttaaacaaacaaattat
tatcataatttattatggttaaataattcaaattattctggtattttatattttaatcca
ttaattaataaaaatcaacaacaacaacaacaacaacaagataatgctgatgatgacgat
gatgatgatgtatctgaaaatgaagaagagcaacaacagaataaaaataaaaaattaaaa
aaaattaaaaatggtaaaatcataaccaattggaatattgcagaatttttaccaccacaa
attcaaacttctttcattattatcatttcagattatatttataaattgcatactgaaaga
gatgaattaaatagaattcaaaaagaacaacaacaaagatatttattaaaacaaaaaatt
agtacaacttcctcctcctctaataatgattcaaccgcagcaacaacaacaactacaaaa
gatactattaatgaaccaactaaaccagatttaagaaaaagttcaacttggaatgaagaa
gaggatgaagatattagtattccaccatcttcatcatcatcaacaactacaactacatca
aaaacaaagaaagctacatctaaatttgatttattaattgatgttaatcgtatttttaca
ttattggatcatttccaagttaatcaatcatcattagaatttccacaattaccaggtggt
tatttgaaattaaataatccaccattagaattcattaaattcgtttgtcatgtattatca
attgataaatcaatctcatcaagagtatcacgtttaagaatgaaattaatgacatcaatg
aaagttagagaattctctgatgaagctaaattcaaagatccatgcgtgtctttcacttta
cctgatgtaatttgttcatcttgtcattcatgtagagatattgatttattaagaaataca
aatacaacttctatctcttcaagattatcttctcaacaaaagagtaacaacaatgacagt
gatgatagtgatgatgataatgaagaaaatgaaggtgatgatgacaatattattagagtt
ccagaattatcttgtattcaatgtaaaggtcattattctaaaaatactatcgaaagtcaa
ttagttgaaatcattcaaagacgttcattatcttatcaattacaagatttaagatgctca
aaatgtaatgatgttaaatctgataaccttggtgatatttgtccacaatgttctggtcaa
tgggaatgtactcaatcaaataatttattttctaaagatttaattatctttaaaagtatt
gcagaatatcataattttgaatggttaggtgagactgttgattcattatccaaatttatt
taa

DBGET integrated database retrieval system