KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273105
Entry
DDB_G0273105      CDS       T00245                                 

Definition
(RefSeq) cytochrome b5 domain-containing protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0273105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0273105
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     DDB_G0273105
Lipid biosynthesis proteins [BR:ddi01004]
 Desaturase
  First
   DDB_G0273105
SSDB
Motif
Pfam: FA_desaturase Cyt-b5 Dehydratase_hem
Other DBs
NCBI-GeneID: 8618815
NCBI-ProteinID: XP_644715
dictyBase: DDB_G0273105
UniProt: Q556T4
Position
2
AA seq 786 aa
MGKGSGAPLKEKVYPSVMYGNIKPIRKQPKSLPKELTIDQILQSLPKEVFETSNFKSACS
LLITILFIGLSATFITLMPSYLTPIGWMLMGASVTGLMVIGNDCIHKTFSKNPLVNSIIG
TIVMLPLLYPFQSYKISEKNNAEKKSTAVLNGEQFKINAHTTTESTNPIRQWATGKFFWI
LSIINWSENYFSTKNLSDKKDKTKAIVSIAIVYIFGFIFFPMMFKFVGVSGFLNYWFAPW
LVLHFLLSTASLLPSIPFYEELQVASKLEKSNNNNNNNKGDKKSSEVEKYLVHITYPQWF
EFIVKDINFSLPRQIAVSIPHYNLRKAYNSFKKSWGEYIYECTFETELFKELIIRSENFS
NEIFSPFDSAPLVPDQEKKAEATAEAVSNSRTSRTVKEFLKSINWLHVIILIGIPFIGLY
GLINVECSLKTFIWSFIYYHFTGMGITAGYHRLWAHKAYSAVLPVRIILLLFGAGAVEGS
CRWWSRDHRAHHRYLDTDKDPYSASLGFWHSHFIWLMFKQDPKKIGRANIDDLNADPWVM
WQHKHYIKIATFMGLVFPTLVAGLGWGDWAGGYFYSGVLRLVTVQHSTFLVNSLAHYLGD
SPYDDEHTPKDSVVTAILTFGEGYHNFHHEFPNDYRNAYKFYQYDPTKWLISAMYYLGLA
YDLKTFSKNEIEKGMIQMHQKHLDAKKQSIYWGINKEDLPSMTIDEFNNLVEKENKKLMI
INKTVLDVESFVNDHPGGLAYIKMGIGKDATSMFTGEVYAHSNAAKNLLCQFSIAKIVDN
HDKKQQ
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgggtaaaggaagtggagctcctttaaaggagaaagtttatccatctgttatgtatgga
aatattaaaccaattagaaaacaaccaaaatcattaccaaaagaattaactattgatcaa
attttacaatctcttccaaaagaagtttttgaaacaagtaattttaaatcagcatgttca
cttttaataacaatcttattcattggtttaagtgcaacattcattactctcatgccatct
tacttaaccccaattggttggatgttaatgggtgcctcagttactggtttaatggtaatt
ggtaatgattgtattcataaaactttttcaaagaatccattagttaattcaattattgga
acaattgtaatgttaccattgttatatccattccaatcttacaagatttcagaaaagaat
aatgcagaaaagaaatcgacagctgttttaaatggtgaacaattcaagattaatgcacat
accacaaccgaaagtacaaatccaattagacaatgggcaactggtaaattcttttggatt
ttatcaattattaattggtctgaaaattatttctcaactaaaaatttatcagataaaaaa
gataaaaccaaagcaatcgtttcaattgcaattgtttacatttttggatttattttcttc
ccaatgatgtttaaatttgtaggtgtaagtggattccttaattattggttcgcaccatgg
ttagttttacatttcttactttcaactgcttcattattaccatcaattccattttatgaa
gaattacaagttgcttcaaaattagaaaaatcaaataataataataacaataacaaaggt
gataagaaatcatctgaagttgaaaaatatttagtacatattacatatccacaatggttt
gaatttattgttaaagatattaatttttcattaccaagacaaattgcagtttcaattcca
cattataatctaagaaaagcttataattcatttaaaaagagttggggtgaatatatttat
gaatgtacatttgaaactgaattatttaaagaattaattatccgtagtgaaaacttttca
aatgaaattttctcaccatttgattcagctccattggtaccagatcaagaaaagaaagca
gaagcaaccgctgaagccgtttcaaatagtcgtacaagtcgtactgttaaagaattttta
aaatcaatcaattggttacatgttatcattttaattggtattccattcattggtctctat
ggtctaattaatgtagagtgttcattgaaaacatttatttggtcatttatttattatcat
ttcactggtatgggtattacagcaggttatcatagactttgggctcataaggcttatagt
gcagttttaccagttcgtattatcttgttgctatttggtgcaggtgctgtcgaaggttca
tgtcgttggtggtcaagagatcatcgtgctcatcatcgttatctcgatactgataaagat
ccatattcagcttcattgggtttctggcattcccatttcatttggttaatgttcaaacaa
gatccaaagaaaatcggtagagcaaacattgacgaccttaacgccgatccatgggttatg
tggcaacataaacattacattaaaatcgccacttttatgggtctcgttttcccaacattg
gtagctggtttaggttggggtgattgggctggtggttatttctactctggtgtacttcgt
ctcgttacagttcaacattccacattcttggtcaattcattggctcattatttaggtgac
tctccatacgatgatgaacatactccaaaggattcagttgtgactgctatattaacattt
ggtgaaggttatcataacttccatcatgaattcccaaatgactatagaaacgcttataaa
ttctatcaatatgatccaactaaatggttgatctctgcaatgtattatttaggcttggct
tatgatttgaaaactttctccaaaaatgaaattgaaaaaggtatgattcaaatgcaccaa
aaacatttagacgcaaagaaacaatcaatctattggggtatcaataaagaagatttacca
tcaatgacaatcgatgaatttaataatttggttgaaaaagaaaataaaaagttaatgata
atcaacaaaaccgtattagatgtcgaatcttttgttaatgatcacccaggtggtttagct
tacattaaaatgggtattggtaaagatgcaacttcaatgtttactggtgaagtttatgct
cattcaaatgctgctaaaaatttattatgtcaattttcaattgctaaaattgttgataat
catgataaaaaacaacaataa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273837
Entry
DDB_G0273837      CDS       T00245                                 

Definition
(RefSeq) delta 9 fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0273837
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0273837
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     DDB_G0273837
Lipid biosynthesis proteins [BR:ddi01004]
 Desaturase
  First
   DDB_G0273837
SSDB
Motif
Pfam: FA_desaturase Cyt-b5 Dehydratase_hem
Other DBs
NCBI-GeneID: 8619161
NCBI-ProteinID: XP_644535
dictyBase: DDB_G0273837
UniProt: Q556T4
Position
2
AA seq 786 aa
MGKGSGAPLKEKVYPSVMYGNIKPIRKQPKSLPKELTIDQILQSLPKEVFETSNFKSACS
LLITILFIGLSATFITLMPSYLTPIGWMLMGASVTGLMVIGNDCIHKTFSKNPLVNSIIG
TIVMLPLLYPFQSYKISEKNNAEKKSTAVLNGEQFKINAHTTTESTNPIRQWATGKFFWI
LSIINWSENYFSTKNLSDKKDKTKAIVSIAIVYIFGFIFFPMMFKFVGVSGFLNYWFAPW
LVLHFLLSTASLLPSIPFYEELQVASKLEKSNNNNNNNKGDKKSSEVEKYLVHITYPQWF
EFIVKDINFSLPRQIAVSIPHYNLRKAYNSFKKSWGEYIYECTFETELFKELIIRSENFS
NEIFSPFDSAPLVPDQEKKAEATAEAVSNSRTSRTVKEFLKSINWLHVIILIGIPFIGLY
GLINVECSLKTFIWSFIYYHFTGMGITAGYHRLWAHKAYSAVLPVRIILLLFGAGAVEGS
CRWWSRDHRAHHRYLDTDKDPYSASLGFWHSHFIWLMFKQDPKKIGRANIDDLNADPWVM
WQHKHYIKIATFMGLVFPTLVAGLGWGDWAGGYFYSGVLRLVTVQHSTFLVNSLAHYLGD
SPYDDEHTPKDSVVTAILTFGEGYHNFHHEFPNDYRNAYKFYQYDPTKWLISAMYYLGLA
YDLKTFSKNEIEKGMIQMHQKHLDAKKQSIYWGINKEDLPSMTIDEFNNLVEKENKKLMI
INKTVLDVESFVNDHPGGLAYIKMGIGKDATSMFTGEVYAHSNAAKNLLCQFSIAKIVDN
HDKKQQ
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgggtaaaggaagtggagctcctttaaaggagaaagtttatccatctgttatgtatgga
aatattaaaccaattagaaaacaaccaaaatcattaccaaaagaattaactattgatcaa
attttacaatctcttccaaaagaagtttttgaaacaagtaattttaaatcagcatgttca
cttttaataacaatcttattcattggtttaagtgcaacattcattactctcatgccatct
tacttaaccccaattggttggatgttaatgggtgcctcagttactggtttaatggtaatt
ggtaatgattgtattcataaaactttttcaaagaatccattagttaattcaattattgga
acaattgtaatgttaccattgttatatccattccaatcttacaagatttcagaaaagaat
aatgcagaaaagaaatcgacagctgttttaaatggtgaacaattcaagattaatgcacat
accacaaccgaaagtacaaatccaattagacaatgggcaactggtaaattcttttggatt
ttatcaattattaattggtctgaaaattatttctcaactaaaaatttatcagataaaaaa
gataaaaccaaagcaatcgtttcaattgcaattgtttacatttttggatttattttcttc
ccaatgatgtttaaatttgtaggtgtaagtggattccttaattattggttcgcaccatgg
ttagttttacatttcttactttcaactgcttcattattaccatcaattccattttatgaa
gaattacaagttgcttcaaaattagaaaaatcaaataataataataacaataacaaaggt
gataagaaatcatctgaagttgaaaaatatttagtacatattacatatccacaatggttt
gaatttattgttaaagatattaatttttcattaccaagacaaattgcagtttcaattcca
cattataatctaagaaaagcttataattcatttaaaaagagttggggtgaatatatttat
gaatgtacatttgaaactgaattatttaaagaattaattatccgtagtgaaaacttttca
aatgaaattttctcaccatttgattcagctccattggtaccagatcaagaaaagaaagca
gaagcaaccgctgaagccgtttcaaatagtcgtacaagtcgtactgttaaagaattttta
aaatcaatcaattggttacatgttatcattttaattggtattccattcattggtctctat
ggtctaattaatgtagagtgttcattgaaaacatttatttggtcatttatttattatcat
ttcactggtatgggtattacagcaggttatcatagactttgggctcataaggcttatagt
gcagttttaccagttcgtattatcttgttgctatttggtgcaggtgctgtcgaaggttca
tgtcgttggtggtcaagagatcatcgtgctcatcatcgttatctcgatactgataaagat
ccatattcagcttcattgggtttctggcattcccatttcatttggttaatgttcaaacaa
gatccaaagaaaatcggtagagcaaacattgacgaccttaacgccgatccatgggttatg
tggcaacataaacattacattaaaatcgccacttttatgggtctcgttttcccaacattg
gtagctggtttaggttggggtgattgggctggtggttatttctactctggtgtacttcgt
ctcgttacagttcaacattccacattcttggtcaattcattggctcattatttaggtgac
tctccatacgatgatgaacatactccaaaggattcagttgtgactgctatattaacattt
ggtgaaggttatcataacttccatcatgaattcccaaatgactatagaaacgcttataaa
ttctatcaatatgatccaactaaatggttgatctctgcaatgtattatttaggcttggct
tatgatttgaaaactttctccaaaaatgaaattgaaaaaggtatgattcaaatgcaccaa
aaacatttagacgcaaagaaacaatcaatctattggggtatcaataaagaagatttacca
tcaatgacaatcgatgaatttaataatttggttgaaaaagaaaataaaaagttaatgata
atcaacaaaaccgtattagatgtcgaatcttttgttaatgatcacccaggtggtttagct
tacattaaaatgggtattggtaaagatgcaacttcaatgtttactggtgaagtttatgct
cattcaaatgctgctaaaaatttattatgtcaattttcaattgctaaaattgttgataat
catgataaaaaacaacaataa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0288801
Entry
DDB_G0288801      CDS       T00245                                 

Definition
(RefSeq) cytochrome b5 domain-containing protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0288801
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0288801
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     DDB_G0288801
Lipid biosynthesis proteins [BR:ddi01004]
 Desaturase
  First
   DDB_G0288801
SSDB
Motif
Pfam: FA_desaturase Cyt-b5 CoV_S2_C
Other DBs
NCBI-GeneID: 8626813
NCBI-ProteinID: XP_636528
dictyBase: DDB_G0288801
UniProt: Q54IE9
Position
5
AA seq 701 aa
MISSPITSCTEAIEMISKLPQEVFEKSTRTATKKLLASIGLVTIGTYLVYALPWYLLPIG
WIFMGTACCGLFSVGYACGNDLFFKNKFVNYVVGTICMLPLMYPLAYWKKRIEKKATASR
DFVREIASGNFWFLSSLLQWLSLNFSFKFSKSMMVSVSFLYVFIALFFPIMTYSMGIWGL
FKYYLIPLFVYHFWMSTFLKASSLSSVASKPTFFALPRWVQYLTQDFNIGVTLSHMSQNL
GVPSYKWKDAYNLLKKEYENITELSFASLLINLPPVVQHVEPKNSTLSVELDEKKQDETS
SSNLFDPVTHPFGLLKVDPSKPFHERINWNVAIFLCGTPFLALYGILTTPFITKTYITAF
LAYYISGMGITAGYHRLFSHRSYRASLPVRIVLMLMGTSTFEGSVFEWCQDHRAHHRFTD
TDKDPYNVKKGLFYSHMGWMLFKRIPGDADISDLKADPVLRFQHKYFIPLAFSLGWFLPM
FICGFGWNDWKGGFFIAGVASKVLMMQCTFCINSLAHYLGEATYTDQRSPRDSFITSLVT
FGEGYHNFHHEFPYDYRNGIHMSAYDPGKWLINFLSWFGFAYELKRFPSELFAKGKIQMQ
EKTIKKLRDQLYWGKPLDQLPSFTRAQVKEKCQKEKKQLLIIEDVIYDMSEFAEKHPGGK
QYIDDYIGKDATKAFNGLVYNHSFAARNYLDLYRVALLSNE
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgatatcatctccaattacctcatgtactgaggcaattgaaatgatctcaaaacttcca
caagaagtatttgaaaaaagtacaagaacagcaacaaagaaattattagcatcaattggt
ttagtgacaattggtacatatttagtatatgcacttccatggtatttgttaccaattgga
tggatatttatgggtacagcatgttgtggattattctctgttgggtatgcatgtggtaat
gatttatttttcaagaataaatttgttaactatgtagttggaacaatttgtatgttacca
ttaatgtatccattagcctattggaagaaaagaattgaaaagaaagcaacagcaagtcgt
gatttcgttcgtgagattgcaagtggtaatttttggttcctcagttcattacttcaatgg
ttatcattaaatttcagtttcaaattctccaaatcaatgatggtctcagtctcattcctt
tatgtattcatcgcattattcttcccaattatgacctacagtatgggcatttggggttta
ttcaagtactatttgatcccattgtttgtgtaccacttttggatgtcaacattcctcaag
gcttcatctctctcaagtgtcgcaagtaaaccaactttctttgccctcccacgttgggta
caatatttaacacaagattttaacattggtgttaccttgagtcacatgtctcaaaatttg
ggtgtaccatcatacaaatggaaagatgcttacaatttattaaagaaagagtatgaaaat
atcactgaattatcatttgcttcactcttgatcaatttaccaccagttgtccaacatgtt
gaaccaaagaattctacactctctgtcgaattggatgaaaagaaacaagatgagacctca
tcctccaatttattcgatccagtaactcatccatttggtttgctcaaggttgatccatca
aaaccattccatgaaagaatcaattggaatgttgctatctttttatgtggtaccccattt
ttagcactctatggtattttaacaactccattcatcactaaaacctatattaccgcattc
ctcgcttactatatctctggtatgggtattacagctggttatcatcgtttattctctcat
cgttcctatagggcttcattaccagttcgtatagttctcatgttaatgggtacatcaact
tttgaaggtagtgttttcgaatggtgccaagatcatcgtgcccatcatcgtttcactgat
accgataaggatccatacaatgtaaagaaaggtcttttctattcccatatgggttggatg
cttttcaaacgtattccaggtgatgccgatattagtgatcttaaagctgatccagtttta
cgtttccaacataaatatttcattccattggcattcagtttgggttggttcttaccaatg
ttcatttgtggttttggttggaatgattggaaaggtggatttttcatcgctggtgttgcc
tccaaagtactcatgatgcaatgtaccttttgtatcaactctttggctcattatcttggt
gaagcaacttacaccgaccaaagatctccacgtgactcttttatcacatctttggtcact
tttggtgaaggttatcataactttcatcatgaattcccatatgattacagaaatggtatt
catatgtctgcttacgatccaggtaagtggttaatcaatttccttagttggtttggtttc
gcctatgaattaaagagattcccaagtgaattattcgcaaaaggtaaaattcaaatgcaa
gagaaaaccatcaaaaaattacgtgatcaactctattggggtaaaccattggatcaatta
ccatcattcactcgtgctcaagttaaagagaaatgtcaaaaagaaaagaaacaactctta
atcattgaagatgttatctatgatatgtctgaatttgctgaaaaacatccaggtggtaaa
caatacattgacgattatattggtaaagatgcaactaaagcttttaatggtttagtttat
aatcattcatttgctgctagaaattatttggatctttatagagttgctttattatcaaat
gaataa

DBGET integrated database retrieval system