KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273139
Entry
DDB_G0273139      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K04482  DNA repair protein RAD51
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0273139
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0273139
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0273139
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0273139
Membrane trafficking [BR:ddi04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    DDB_G0273139
Ubiquitin system [BR:ddi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    DDB_G0273139
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     DDB_G0273139
    RecA family proteins
     DDB_G0273139
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     DDB_G0273139
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase DnaB_C AAA_22 HHH AAA_28
Other DBs
NCBI-GeneID: 8618930
NCBI-ProteinID: XP_644828
dictyBase: DDB_G0273139
UniProt: Q557E6
Position
2
AA seq 351 aa
MASRQRQEEEEVDIENEQQQEEEEEEEEEESYLSINKLEGNGINAADLKKLQEQGLNTVQ
AVAFTTKKTLTGIKGISEQKADKLLAEAKKLVFMGFRTATDINKARAEIIQITTGSKEFD
SLLDGGIESGSITEIFGEFRTGKTQICHTLCVTCQLGYSQGGGEGRALYIDTEGTFRPER
LLAIAERYNLNGEHVLDNVSYARAYNSDHQLELLVQASAMMSESRYALLIVDSATALYRT
DYAGRGELADRQKHLARFLRTLQRLADEFGVAVVITNQVVASVDGAGGMFNPDPKKPIGG
HIMAHSSTTRLSLRKGKGEMRICKIYDSPSLPESEKPFGIYSDGISDYKEQ
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcatcaagacaaagacaagaagaagaagaagttgatattgaaaatgaacaacaacaa
gaagaggaagaagaagaagaggaggaagagtcatatttatcaattaataaattagaaggt
aatggtattaatgcagcagatttaaagaaacttcaagaacaaggtttaaatacagtacaa
gcagttgcttttacaacaaagaaaacattaacaggtatcaaaggtatctctgagcaaaaa
gctgataaacttttagcagaagcaaagaaattagtttttatgggctttcgtactgcaacc
gatattaataaagcaagagctgaaattattcaaattacaactggttcaaaagaatttgat
tctttattagatggtggtattgaatctggttcaattactgaaatttttggtgaatttaga
actggcaaaactcaaatttgtcatacattatgtgtaacatgtcaacttggttatagtcaa
ggtggtggtgaaggtcgtgctttatatattgatacagaaggaacattccgtccagagaga
ttgttagcaattgcagagagatataatttaaatggtgaacatgttttggataatgtttca
tatgctcgtgcatacaatagtgatcatcaattagagttattagttcaagcatctgcaatg
atgagtgaatcacgttatgctttattgattgttgattccgcaaccgcattatatagaaca
gattacgccggtagaggtgagttggcagatagacaaaaacatttagcacgtttcctacgt
actcttcaaagattagccgatgagtttggtgttgccgtcgttattacaaatcaagtcgtt
gcatctgttgatggtgctggtggtatgtttaatcccgatccaaagaagccaattggtggt
catattatggcccactcttcaacaactcgtttatctttacgtaaaggtaaaggtgaaatg
agaatttgtaaaatttatgattctccatcacttcctgaaagtgaaaagccttttggtatt
tacagtgatggtatctccgattataaagaacaataa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0273611
Entry
DDB_G0273611      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K04482  DNA repair protein RAD51
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0273611
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0273611
   04121 Ubiquitin system [BR:ddi04121]
    DDB_G0273611
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0273611
Membrane trafficking [BR:ddi04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    DDB_G0273611
Ubiquitin system [BR:ddi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    DDB_G0273611
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     DDB_G0273611
    RecA family proteins
     DDB_G0273611
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     DDB_G0273611
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase DnaB_C AAA_22 HHH AAA_28
Other DBs
NCBI-GeneID: 8619047
NCBI-ProteinID: XP_644422
dictyBase: DDB_G0273611
UniProt: Q557E6
Position
2
AA seq 351 aa
MASRQRQEEEEVDIENEQQQEEEEEEEEEESYLSINKLEGNGINAADLKKLQEQGLNTVQ
AVAFTTKKTLTGIKGISEQKADKLLAEAKKLVFMGFRTATDINKARAEIIQITTGSKEFD
SLLDGGIESGSITEIFGEFRTGKTQICHTLCVTCQLGYSQGGGEGRALYIDTEGTFRPER
LLAIAERYNLNGEHVLDNVSYARAYNSDHQLELLVQASAMMSESRYALLIVDSATALYRT
DYAGRGELADRQKHLARFLRTLQRLADEFGVAVVITNQVVASVDGAGGMFNPDPKKPIGG
HIMAHSSTTRLSLRKGKGEMRICKIYDSPSLPESEKPFGIYSDGISDYKEQ
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcatcaagacaaagacaagaagaagaagaagttgatattgaaaatgaacaacaacaa
gaagaggaagaagaagaagaggaggaagagtcatatttatcaattaataaattagaaggt
aatggtattaatgcagcagatttaaagaaacttcaagaacaaggtttaaatacagtacaa
gcagttgcttttacaacaaagaaaacattaacaggtatcaaaggtatctctgagcaaaaa
gctgataaacttttagcagaagcaaagaaattagtttttatgggctttcgtactgcaacc
gatattaataaagcaagagctgaaattattcaaattacaactggttcaaaagaatttgat
tctttattagatggtggtattgaatctggttcaattactgaaatttttggtgaatttaga
actggcaaaactcaaatttgtcatacattatgtgtaacatgtcaacttggttatagtcaa
ggtggtggtgaaggtcgtgctttatatattgatacagaaggaacattccgtccagagaga
ttgttagcaattgcagagagatataatttaaatggtgaacatgttttggataatgtttca
tatgctcgtgcatacaatagtgatcatcaattagagttattagttcaagcatctgcaatg
atgagtgaatcacgttatgctttattgattgttgattccgcaaccgcattatatagaaca
gattacgccggtagaggtgagttggcagatagacaaaaacatttagcacgtttcctacgt
actcttcaaagattagccgatgagtttggtgttgccgtcgttattacaaatcaagtcgtt
gcatctgttgatggtgctggtggtatgtttaatcccgatccaaagaagccaattggtggt
catattatggcccactcttcaacaactcgtttatctttacgtaaaggtaaaggtgaaatg
agaatttgtaaaatttatgattctccatcacttcctgaaagtgaaaagccttttggtatt
tacagtgatggtatctccgattataaagaacaataa

DBGET integrated database retrieval system