KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0274339
Entry
DDB_G0274339      CDS       T00245                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00071  Fatty acid degradation
ddi00280  Valine, leucine and isoleucine degradation
ddi00592  alpha-Linolenic acid metabolism
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01212  Fatty acid metabolism
ddi04146  Peroxisome
Module
ddi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DDB_G0274339
   00592 alpha-Linolenic acid metabolism
    DDB_G0274339
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0274339
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DDB_G0274339
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0274339
Enzymes [BR:ddi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     DDB_G0274339
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Myosin_N ACP_syn_III_C
Other DBs
NCBI-GeneID: 8619351
NCBI-ProteinID: XP_643924
dictyBase: DDB_G0274339
UniProt: Q86IY4
Position
2
AA seq 416 aa
MSFNSRIETISRHLSTGPILESNPTSGSVKSGDDIVIVAPFRTAICKAKRGAFKETAPDD
LLAPVIKHIIKVTKLDPKLIGDVVMGAVLPRSSQGATEVRVATLLAGLPKEVPCYTVNRQ
CSSGLQAIANCAAAVKAGFYDIGLAGGVESMSLNPMAWDGGFNEVAQEDPIISGCYNTMG
QTSENVAERFGVTRKDQDEFSVNSHKKAGAAQKAGKFDDEIVPVTVKTEDGKTIVVDKDE
GIREKTTVADLAKLKPAFKEGGTTTAGNSSQMSDGAAACLVMKRSTAERLGLKVELVFVA
FAAVGVEPSIMGIGPAVAIPAALKQAGLTTKDIDVFEINEAFASQAFYSCKVLGLDMNKV
NPNGSGIALGHPLGATGARQMATISRELHRRKGKYGVISMCIGTGLGAAAVVRTDY
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtcattcaattcaagaattgaaactatttctcgtcacttaagcactggaccaatttta
gaatcaaatccaacttctggatcagttaaatcaggagatgatattgtaattgttgcacca
tttcgtacagcaatttgtaaagctaaaagaggagcattcaaagagacagcaccagatgat
ttattagcaccagttattaaacatattatcaaagttaccaaattagatccaaaattaatt
ggagatgttgttatgggagcagtattaccaagatcatcacaaggtgcaaccgaagttaga
gttgccacattattagcaggtttaccaaaggaagtaccatgttatacagtcaacagacaa
tgttcatcaggtttacaagcaattgccaattgtgcagcagcagtcaaagcaggtttctat
gacattggtttagcaggcggtgtagaatcaatgagtttaaatccaatggcatgggatggt
ggtttcaacgaggttgcccaagaggatccaatcattagtggttgttacaacactatgggt
caaacctctgaaaatgtcgcagagcgttttggtgtcaccagaaaagaccaagatgaattc
tctgtaaattcacacaagaaggcaggtgccgcccaaaaagcaggtaaatttgacgatgaa
atcgttccagtcaccgtaaagaccgaggatggcaaaaccatcgtcgtcgataaagacgaa
ggtatccgtgagaaaaccaccgttgcagatttggccaaattaaaaccagctttcaaagag
ggtggtacaaccaccgctggtaactctagtcaaatgagtgatggtgccgccgcttgttta
gttatgaaaagaagtaccgccgaaagattgggtctcaaggttgaattggttttcgtagct
tttgctgctgtcggtgtcgaaccatccattatgggtattggtccagccgttgcaattcca
gccgccttaaaacaagctggtctcaccactaaagatatcgacgtttttgaaatcaatgaa
gcttttgcttctcaagcattttacagttgtaaggttttgggtttggatatgaacaaagtt
aatccaaatggctctggtatcgctttaggtcatccattaggtgctactggtgcccgtcaa
atggctaccatttcaagagaattacatcgtcgtaaaggtaaatatggtgtaatctctatg
tgtattggtactggcttaggtgctgcagctgttgttcgtacagattattaa

DBGET integrated database retrieval system