KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275049
Entry
DDB_G0275049      CDS       T00245                                 

Definition
(RefSeq) short-chain dehydrogenase/reductase family protein
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00062  Fatty acid elongation
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01212  Fatty acid metabolism
Module
ddi_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0275049
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0275049
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0275049
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     DDB_G0275049
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     DDB_G0275049
Lipid biosynthesis proteins [BR:ddi01004]
 Fatty acid synthase
  Component type
   DDB_G0275049
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 Sacchrp_dh_NADP NAD_binding_10
Other DBs
NCBI-GeneID: 8619879
NCBI-ProteinID: XP_643832
dictyBase: DDB_G0275049
UniProt: Q869Y3
Position
2
AA seq 307 aa
MSFTTVIQSVALSIGLGILLRYAARFVLFLYAYFVRSPININKYGSWVVVTGATDGIGKA
YCHEFAKKKLNVVLVSRSLDKLKEVASEIENKFKVQTKVISFDFNTTDDSKYQELFKQLS
GIDIGVLVNNVGISYDHPMYLEELQPASIESLINLNVRAATVLSKFILTSMVEKKRGAII
NLASVSGITPIPLLTVYSGTKAYIEKFSLALNLEYASKGIFVQCVTPGIVCSKMSKVRKS
SLFVPQPSSFARSAIATIGYDRLTTGYWSHEIQAFFLRSLPSFVVDKVMFDMHLGQRKRA
LNKKKSQ
NT seq 924 nt   +upstreamnt  +downstreamnt
atgtctttcaccactgtcatccaaagtgttgccctttcaatcggtcttggtattttactt
agatatgcagcccgtttcgttttattcttatatgcctactttgttagatcaccaatcaat
attaataaatatggtagttgggttgttgtaactggtgcaactgatggtattggtaaggct
tattgccatgaatttgctaaaaaaaaattaaatgttgttttagttagtagaagtttagat
aaattaaaagaagtagcttcagaaattgaaaataaatttaaagttcaaactaaagttatt
tcatttgattttaatacaactgatgatagtaaatatcaagaattatttaaacaattatca
ggaattgatattggtgttttagttaataatgttggtatttcatatgatcatccaatgtat
cttgaagaattacaaccagcatcaattgaatcattgattaatttaaatgttagagcagca
actgttttatcaaaattcatactcacttcaatggttgaaaagaagagaggtgcaatcatc
aatttagcatcagtcagtggtatcactccaattccattactcacagtttacagtggtaca
aaagcatacattgaaaaattctcattggctcttaatttagagtatgcttcaaagggtatt
ttcgttcaatgtgtcaccccaggtattgtttgtagtaaaatgtcaaaggttcgtaaatca
tctctctttgttccacaaccatccagtttcgctagatccgctattgcaaccattggttat
gatagactcaccactggttattggagtcatgaaattcaagctttcttcttaagaagttta
ccatcttttgtcgttgataaagttatgtttgatatgcatttaggtcaaagaaagagagct
cttaataaaaagaaatctcaataa

DBGET integrated database retrieval system