KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0275257
Entry
DDB_G0275257      CDS       T00245                                 

Gene name
top3
Definition
(RefSeq) DNA topoisomerase III
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0275257 (top3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0275257 (top3)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0275257 (top3)
Enzymes [BR:ddi01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     DDB_G0275257 (top3)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Topoisomerases
   DDB_G0275257 (top3)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     DDB_G0275257 (top3)
   FA (Fanconi anemia) pathway
     DDB_G0275257 (top3)
SSDB
Motif
Pfam: Topoisom_bac Toprim SUIM_assoc
Other DBs
NCBI-GeneID: 8619798
NCBI-ProteinID: XP_643754
dictyBase: DDB_G0275257
UniProt: Q8T2T7
Position
2
AA seq 828 aa
MTKRILNVAEKPSAAKEIAAILSNKRATVREGFSKYNKLWDFKYNILNFNDCEMTFTSVT
GHLMEIDVVEQFKPWASCDPIQLFDAPIRKTVPSDKEPLKKTLEREIKKADILILWLDCD
REGENIAFEVLEVCKNAKKKFEFYRAHFSAIIPREIDRACKNLAKPNEKDSIAVDTRMEI
DLRIGAAFTRFQTLYLKKFKIISNSDNQPKTTTPANGNILNNSNNNSSGKEIISYGPCQF
PTLGFVVERYFRIVNFKPEDFWHLSVVHEKMDTSSGKMIPVTFSWCRNRLFDYTAAFILY
EKCLDNTEATVVDVTSKESRYRPVPLTTIELQKAASKKLRISSVQTMQYAEELYTKGLIS
YPRTETDSFQAGTDLKGLIGNQASNPEWGAYASRLINNNQFVYPKSGKNNDNSHPPIHPT
SSATGLSGNLKKIYDFITRRFLACCSEESVFANTTVTIDIQGERFSETGTMVLKLGYLEV
YPFDKRNDKLIPTYQKGERFTPKRIDLTKGTTVAPHYITEAELLTAMDNNKIGTDATMAT
HIQTIQDRFYVKKNESNQFVPSNLGVSLVASYELMGFEFSKPNLRAAIEADVDKISRGQK
TKQEVLLSTIEKYKQLYQLANQNINCFDRSFREYYEPADPKGGEFRVLVSQFSRCGKCNG
KMQYKSDQNPEAPKRILFCPQCIDTFDLPKNGDISQLVTSMGVPQNCPICQYQVLSVRNP
INDKSYTICPKCRNSPPDPIHKKPFHCFQCTFNCNLATGNKQQQQQQQQQQQQTNYNRNN
NNNNTNSARPITTRTTRTTTQHRTFTASNNNFNNNNRNSDRNNNNFIF
NT seq 2487 nt   +upstreamnt  +downstreamnt
atgacaaaaaggatattgaatgttgctgaaaaaccatcagcagcaaaagagattgcagca
atattatcaaataaaagagcaacagttagagaaggattttcaaaatataataaactttgg
gattttaaatataatatattgaattttaatgattgcgaaatgacattcacatcagttaca
ggtcatttaatggagattgatgtagttgaacaatttaaaccatgggcatcatgcgatcca
attcaattatttgatgcaccaataagaaaaacagtaccatcagataaagaaccattaaag
aaaacattggaaagagagataaagaaagctgatatattaattctttggttagattgtgat
agagagggtgaaaatattgcatttgaagtattggaagtttgtaaaaatgctaaaaagaaa
tttgaattttatagagcacatttctctgcaatcattccaagagaaattgatagagcttgt
aaaaaccttgcaaaaccaaatgaaaaagattcaattgcagttgatactagaatggagatt
gatcttagaattggtgctgctttcacaagatttcaaactttatatttaaagaaatttaaa
atcatttcaaatagtgataatcaaccaaagactactacaccagcaaatggtaatatactt
aataatagtaataataattcaagtggtaaagaaattattagttatggaccatgccaattt
ccaactttaggatttgtagttgaaagatattttagaattgtaaattttaaaccagaggat
ttttggcatttatcagtggttcatgaaaaaatggatactagtagtggtaagatgatacct
gttacattttcatggtgtagaaatcgtttgtttgattatacagctgcatttatattgtat
gagaaatgtttagataatacagaggcaacggttgttgatgttacttcaaaagagagtaga
tatagacctgtacctttgacaacgattgaacttcaaaaggcggcatcgaaaaagttaaga
atttcatcagttcaaactatgcaatatgcagaggaactttatacaaaaggcttaattagt
tatccaagaacagagacagattcatttcaagcaggaaccgatttaaaaggtttgattggt
aaccaagcatcaaatcctgaatggggtgcttatgcaagtagattaattaataacaatcaa
tttgtttatccaaaatcaggtaaaaacaatgataattcacatccaccaattcatccaact
tcatcagccactggtttatcgggtaatttgaaaaagatttatgatttcattactcgtaga
tttttagcatgttgttctgaggaatctgtatttgcaaatacaacggttaccatcgatatt
cagggtgaaagattttcagagactggtacaatggttttgaaattgggttatcttgaagtt
tatccattcgataaacgtaatgataaactaataccaacctatcaaaaaggtgaaagattt
acaccaaaaagaattgatcttacaaaaggtacaaccgttgcacctcattatataacagag
gcagaactattgacagccatggataataataaaatcggtacagatgcaacgatggcaact
catattcaaactattcaagatcgtttttatgttaaaaagaatgaaagtaatcaatttgtt
ccctcaaatttaggtgtatcattggttgcaagttatgaattaatgggatttgaattttca
aaaccaaatcttagagctgcaatcgaagctgatgtagataaaattagtagaggtcaaaaa
actaaacaagaagtactcttatcaaccattgaaaagtataaacaactttatcaattggca
aatcaaaatataaattgtttcgatagatcatttagagaatattatgaacctgccgatcca
aaaggtggtgaatttcgtgttttggtttctcaattctcacgttgtggtaaatgtaatggt
aaaatgcaatataaatctgatcaaaatccagaagcaccaaaaagaattttattttgtcct
caatgtattgatacttttgatttaccaaagaatggtgatatctctcaattggtaacttca
atgggtgtaccacaaaattgtccaatttgtcaatatcaagttcttagtgtaagaaatcct
ataaacgataaaagttatacaatttgtccaaaatgtagaaattctccacctgacccaatt
cataaaaaaccatttcattgttttcaatgtacatttaattgcaatttagcaactggtaat
aaacaacaacaacaacaacaacaacaacaacaacaacaaacaaattataatagaaataat
aacaataataacacaaatagcgcaagaccaataacaactagaacaactagaacaacaact
caacatagaacttttacagcatctaataataattttaataataacaatagaaattcagat
cgtaataataataattttattttttaa

DBGET integrated database retrieval system