KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0277247
Entry
DDB_G0277247      CDS       T00245                                 

Gene name
apnB
Definition
(RefSeq) hypothetical protein
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DDB_G0277247 (apnB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0277247 (apnB)
Enzymes [BR:ddi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     DDB_G0277247 (apnB)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DDB_G0277247 (apnB)
 Prokaryotic type
     DDB_G0277247 (apnB)
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-GeneID: 8620949
NCBI-ProteinID: XP_642760
dictyBase: DDB_G0277247
UniProt: Q86K43
Position
2
AA seq 349 aa
MTTPIVTRNRSSIISSPYFSTSTKLTTVTTTIKDKNDETPKKIIKREQIKIEYEEKEEEL
EEKGDKKRQRNKKEKKIKNDIKKEEEEEKEEEEEEKVIEDIKIKTHINGISLAKIHWKEV
WDKIKIMRSENLAPVDTLGAESFNQDNIEPIEKRFHILVGCLLSSQTKDAITHAAVVRLK
EYGLTVDKMLTIDTNELETLLYPVGFYKRKAIYLKKIAEILKNKYNGDIPPTFKEIEQLP
GIGPKMTNLIVQIAWGRVEGIAVDVHMHRISNRLGWVKTKTPEETMKDLESWLPKENWAT
VNHLLVGFGQTICSPVNPKCSNCLVNNLCPVGIIEMNSSKKKIKKKIKK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacaacaccaattgtaacaagaaatagatcatctattatttcatcaccttatttttcg
acatcaacaaaactgacaacagtaacaactacaataaaagataaaaatgatgaaacacca
aaaaaaataataaaaagagaacaaattaaaatagaatatgaagaaaaagaagaggaacta
gaagaaaaaggagataaaaaaagacaaagaaataaaaaagagaaaaaaataaaaaatgat
atcaaaaaggaagaagaagaagaaaaagaggaagaagaagaagaaaaagtaattgaagat
attaaaattaaaacacatattaatggtatatcattagcaaaaattcattggaaagaagtt
tgggataaaattaaaataatgagaagtgaaaatttggcaccagttgatacattgggagcg
gaatcatttaatcaagataatattgaaccaattgaaaagagatttcatatattagttggc
tgtttattatcatcacaaaccaaggatgcgattacccatgcagcagtagtaagattaaaa
gagtatggattaacagttgataaaatgttaacaattgataccaatgaattggagacacta
ttatatccggttggattctataaaagaaaagcgatttaccttaaaaagattgcagagatt
ttaaagaataaatacaatggtgatataccaccaacattcaaagagattgaacaattacca
ggtattggaccaaaaatgaccaatttaatagttcaaatagcttggggtagagttgaaggt
atagccgttgatgttcatatgcatagaatttcaaatagattaggttgggtcaaaactaaa
actcctgaagagacaatgaaggacttggaatcttggttaccaaaagaaaattgggctact
gtcaatcatctattagttggtttcggtcaaactatttgttcacctgtaaatccaaaatgt
tcaaattgtttagtaaataatttatgtcctgttggaataattgaaatgaattcttcaaaa
aagaaaataaaaaagaaaataaaaaagtaa

DBGET integrated database retrieval system