KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0278113
Entry
DDB_G0278113      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00062  Fatty acid elongation
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01212  Fatty acid metabolism
Module
ddi_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0278113
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0278113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0278113
Enzymes [BR:ddi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     DDB_G0278113
Lipid biosynthesis proteins [BR:ddi01004]
 Fatty acid synthase
  Component type
   DDB_G0278113
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 8621341
NCBI-ProteinID: XP_642133
dictyBase: DDB_G0278113
UniProt: Q54YR9
Position
3
AA seq 225 aa
MVSIKNLYLVLYNVIQTIGWSIILFKLSIHLFETQSPVGVWEKVGALVSIFQYAAVLEIV
HSVFGLVKTSAATTFIQVFSRVACVFLAQNVPTTQNHFFLSLMLMSWSITEVIRYSFYAL
SILKIDSYILGWLRYTTFIILYPTGVTGETGTIWTSLEFVKNTKFMTLTMPNSLNFAFDF
HNILIFSLGFYVIGLPYLYTYMLGQRKKFIASHKKGSTTNIKKTN
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtatcaattaaaaatttatatttagtattatataatgttatacaaacaattggatgg
agtattatattatttaaattaagtattcatttatttgaaactcaatcaccagttggagtt
tgggaaaaagttggagcgttagtatcaatttttcaatatgcagcagtattggagattgtt
cattcagtatttggtttagtaaagacatcagcagctacaacatttattcaagtattttca
cgtgttgcatgtgtattcttggcacaaaacgtaccaaccactcaaaaccatttcttcctt
tcattgatgttaatgtcatggtcaattacagaagtaattcgttatagtttttacgcactt
tcaattctaaagatcgattcttacattttgggttggttaagatacacaactttcatcata
ctctatccaaccggtgtcactggtgaaactggtacaatttggacaagtttggaattcgtc
aagaacactaaatttatgacattgacaatgccaaattctttgaatttcgcattcgacttc
cataatattttaattttctctttaggtttctacgttattggtttaccatatctttacact
tatatgttaggtcaaagaaagaagtttattgcttctcataaaaaaggttcaactacaaat
attaaaaaaacaaattaa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0278683
Entry
DDB_G0278683      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00062  Fatty acid elongation
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
ddi01212  Fatty acid metabolism
Module
ddi_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    DDB_G0278683
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0278683
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ddi01004]
    DDB_G0278683
Enzymes [BR:ddi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     DDB_G0278683
Lipid biosynthesis proteins [BR:ddi01004]
 Fatty acid synthase
  Component type
   DDB_G0278683
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 8621553
NCBI-ProteinID: XP_642348
dictyBase: DDB_G0278683
UniProt: Q54Y54
Position
3
AA seq 189 aa
MVKTDSALYLGFSSSIPTTYISLGSTVCFVQVLAFLEILHVLLGFTKSSLIPTMSQVFGR
NHVLLLALAFTPEVQRHWGVWTMFFIWGLSELIRFPYYLYGSNSPKFLTWLRYNAFIILY
PLGFLSENILWYNMLPIILERRIHFIDMPNKFNFGFNYYYFLLVWITLTLMVFPQQYMHM
FKLRAKKMN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggtgaaaactgattcggctttatatttgggattctcatcttcaataccaactacatac
atatcattaggatcaacagtttgttttgtacaagttttagcatttttagagattttacat
gttttattaggtttcaccaaatcatcattaataccaacaatgtcacaagtttttggaaga
aatcatgtattacttttggcattagcatttacaccagaagttcaacgacattggggtgta
tggacaatgttttttatttggggactcagtgagttaattagattcccatactatttatat
ggtagtaactctccgaaatttttaacttggttacgttataatgcttttattattctttat
cctttaggattcctttcagagaatatactatggtataatatgctgccaataattttagaa
agaagaattcattttatagatatgccaaataaatttaattttggatttaactattattat
tttttattagtttggataactttgactttgatggttttcccacaacaatatatgcatatg
tttaaattaagagcaaaaaagatgaattaa

DBGET integrated database retrieval system