KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0279209
Entry
DDB_G0279209      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K07466  replication factor A1
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03420  Nucleotide excision repair
ddi03430  Mismatch repair
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0279209
   03420 Nucleotide excision repair
    DDB_G0279209
   03430 Mismatch repair
    DDB_G0279209
   03440 Homologous recombination
    DDB_G0279209
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ddi03000]
    DDB_G0279209
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0279209
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0279209
Transcription factors [BR:ddi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    DDB_G0279209
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    DDB_G0279209
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     DDB_G0279209
   MMR (mismatch excision repair)
     DDB_G0279209
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     DDB_G0279209
SSDB
Motif
Pfam: DUF5052 tRNA_anti-codon
Other DBs
NCBI-GeneID: 8621923
NCBI-ProteinID: XP_641727
dictyBase: DDB_G0279209
UniProt: Q54X50
Position
3
AA seq 132 aa
MSTENNAPPLTQPTFSKVSSLKPMSTGHNLILKVVSTKVVIEKNKDKKEMISEAVVGDET
GTIILTVKNEQNDVVQPGNTIILRNGIIKVFNGFMRLYVNIWGNIKLSPTPSDFVVNNSN
DLSAIEYELKRT
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtccactgaaaataatgcaccacctttaacacaaccaactttttcaaaggtatcatct
ttaaaaccaatgtcaacaggtcataatttaattttaaaagtagttagtacaaaagttgta
attgaaaagaataaagataagaaagaaatgatatcagaagctgttgttggtgatgaaact
ggtacaattatattaactgttaaaaatgaacaaaatgatgttgtacagccaggtaataca
attatattaagaaatggaattattaaagtatttaatgggtttatgcgtttatatgtaaac
atttggggtaatataaaattatcaccaactccttctgattttgttgtaaacaattcaaat
gatttatctgcaatagaatatgaattaaagagaacttaa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0289513
Entry
DDB_G0289513      CDS       T00245                                 

Gene name
rfa1
Definition
(RefSeq) OB fold-containing protein, nucleic acid binding
  KO
K07466  replication factor A1
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03420  Nucleotide excision repair
ddi03430  Mismatch repair
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0289513 (rfa1)
   03420 Nucleotide excision repair
    DDB_G0289513 (rfa1)
   03430 Mismatch repair
    DDB_G0289513 (rfa1)
   03440 Homologous recombination
    DDB_G0289513 (rfa1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ddi03000]
    DDB_G0289513 (rfa1)
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0289513 (rfa1)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0289513 (rfa1)
Transcription factors [BR:ddi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    DDB_G0289513 (rfa1)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    DDB_G0289513 (rfa1)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     DDB_G0289513 (rfa1)
   MMR (mismatch excision repair)
     DDB_G0289513 (rfa1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     DDB_G0289513 (rfa1)
SSDB
Motif
Pfam: REPA_OB_2 tRNA_anti-codon CDC24_OB3 Rep_fac-A_C POT1 HypA DUF35_N Gti1_Pac2
Other DBs
NCBI-GeneID: 8627182
NCBI-ProteinID: XP_636195
dictyBase: DDB_G0289513
UniProt: Q54HE3
Position
5
AA seq 679 aa
MSINRGCLTNIINVDQTKRFQNIDCRVQVIKTKQSSSNNLEIHLSDQDHIFVGISKTDPS
NIPINSIVNLSDFSINFPKRFLNIVQFNVISQEKEIKTAQGKALTYHSVYKKTDGNSQNS
NQPQPQQQQQHQQQQQPRANTTMGSNSGIASRGNPLANQRNQAGAIRSNNNFGGNSNNNN
NNNYNNNNNNNNNNSGGGSNNFYADLSTQPITDIESIAPGMNVQFTIRAMVRNKQPLKSW
NKGANGEGKLFSMELVDSTGEIKCACFSDSSNPNNFINALYDCFENGKVYFIQRFFVKSA
NKLYNTLSHQSELSINSESRVMISPDQTQFTPHYNFKKIADIENLEKNDTVDVIGAITNI
DPIANLTSKQGKEFTKFGITIADDTNASINVVFWNEKATEVAPQVKVGDIIAMKGVKVSD
FSGRTLSYSFGSSFGLNDEQLQETSNLRAHLQNFDVNSLQSLTIASSYTQSSYEQVNLPI
FLIRTISEGSPLFISDPKTNKKLYRTIGQFQRVVPLSQAGEMDKGDEISSKMEWKYKACK
KCKKSCPEGSCPQCGSDDWEYAYRMSLKLSDGDDAISVEVMGKTGDRLFGKSAAELYQMN
QEQINEIFNTVLSNNYVVSLAPSSYMGSNGQTYNRFNVYDFANLYDTPNKLVSGPNPNAP
NQFQNYIESSFNDCRLFNE
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgtcaattaatcgtggatgtttaacaaatattattaacgttgaccaaactaaacgtttt
caaaatattgattgtagagttcaagttataaaaacaaaacaatcttcaagtaataattta
gaaattcatttatcagatcaagatcatatttttgttggtatttcaaagactgatccatca
aatattccaatcaattcaattgttaacctaagtgatttctctataaactttccaaaaaga
ttccttaatatcgttcaattcaatgttatctctcaagaaaaagaaattaaaaccgcacaa
ggtaaagctttaacatatcactcagtatataaaaaaacagatggcaatagtcaaaacagt
aatcaaccacaaccacaacaacaacaacaacatcaacaacaacaacaaccaagagcaaat
acaacaatgggctcaaatagtggaattgcatcaagaggtaatcctttagcaaatcaaaga
aatcaagcaggtgcaattagatcaaataataattttggtggtaatagtaataataataat
aataacaattataataacaacaataataataataataataatagtggtggtggttcaaat
aatttttatgcagatttatcaacacaaccaattacagatattgaaagtatagcacctggt
atgaatgttcaatttacaatcagagcaatggttagaaataaacaaccattaaaaagttgg
aataagggagccaatggtgaaggtaaactttttagtatggaattggtagatagtactggt
gaaattaaatgtgcttgtttctctgatagttcaaatccaaacaactttatcaatgcactc
tatgattgctttgaaaatggtaaagtctatttcattcaaagattctttgttaaaagtgca
aacaaattatacaatacactctcacatcaatctgaactcagtatcaactctgaatcaaga
gtaatgattagtccagatcaaacccaattcactccacattataatttcaaaaagattgct
gatattgaaaacttggaaaagaacgacactgtcgatgttattggtgccattacaaacatt
gatccaatcgccaatctcactagcaaacaaggtaaagaattcaccaaatttggtatcacc
atcgccgatgacaccaatgccagtatcaatgtcgttttttggaatgaaaaagccactgaa
gttgcacctcaagtaaaggttggtgatatcattgcaatgaagggtgtaaaagtttccgat
ttctctggtagaacactctcttatagttttggttcatcctttggattgaatgatgaacaa
cttcaagaaaccagtaatcttcgtgcacatttacaaaactttgatgtcaattctcttcaa
tcacttaccattgcaagttcctacacccaaagttcctatgaacaagttaatcttccaatc
tttttaatcagaaccatctctgaaggttcaccactcttcatttcagatccaaaaacaaat
aaaaaactctatcgtacaatcggtcaattccaacgtgtcgttcctttaagtcaagctgga
gagatggacaaaggtgatgaaatctcttccaaaatggaatggaaatataaagcatgcaaa
aaatgtaaaaaatcttgtccagaaggtagttgcccacaatgtggttcagatgattgggaa
tatgcttatcgtatgagtttgaaattatccgatggtgatgatgcaatcagtgttgaggta
atgggtaaaactggtgatagattatttggtaaaagcgctgcagaattatatcaaatgaat
caagaacaaatcaatgaaatctttaacactgtacttagtaacaattatgttgtttcactt
gccccaagctcttatatgggtagcaatggtcaaacttacaacagattcaatgtctatgat
tttgcaaatctctatgatacaccaaacaaactagtttctggtccaaatccaaatgctcca
aatcaattccaaaattatattgaaagtagttttaatgattgtagattatttaatgaataa

DBGET integrated database retrieval system