KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281467
Entry
DDB_G0281467      CDS       T00245                                 
Name
(RefSeq) hypothetical protein
  KO
K23174  beta-pinacene synthase [EC:4.2.3.200]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DDB_G0281467
Enzymes [BR:ddi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.200  beta-pinacene synthase
     DDB_G0281467
SSDB
Motif
Pfam: Terpene_syn_C_2 DUF6546
Other DBs
NCBI-GeneID: 8623083
NCBI-ProteinID: XP_640697
dictyBase: DDB_G0281467
UniProt: Q54TW4
Position
3:4547456..4548845
AA seq 347 aa
MLCFNDFNFPKEWEVVPNSFKYIDIVIKEIIGFGLIKENDQELKMIVNQAISIAAYFWPY
ANEEQMVMGGSVLCWCVLFDDPLDTNKLDEKKGLEIVSRTEKLLLTRTLPNNPTNLEKYG
FTIFEKCLKYCGTNTHMYDMLIKLTVQWIYSIIPFNKLNESPVHPETLKYIRKINIGIEF
TQSIFYIINSNNKVDLIVLANPLYQKLVDLSSLNISFVNDAASFCKEIKDGGSDNNLFII
LMKRLGGIEFIKEAYKQLTDLSNGYIDEFCYYEKLLLSSLSKQQQNEIQIFIDHLKYLMK
GNQIWSTKTIRYATEDHPIIQLRNSTNKLIENNINMDKVSLTNKNYI
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgttatgctttaatgattttaattttccaaaggaatgggaagtagtaccaaattcattc
aaatatattgatatagtaataaaagaaataattggttttggtttaatcaaagaaaatgat
caagaattaaaaatgattgtaaatcaagccatttcaattgctgcttatttttggccatat
gcaaatgaagaacaaatggtaatgggagggtcagtactgtgttggtgtgtcttatttgat
gatccactagatacaaataaattagatgaaaaaaaaggtttagaaattgttagtagaaca
gagaaattacttttaactagaactttaccaaataaccccacaaatcttgaaaagtatgga
tttacaatttttgaaaaatgtttaaaatattgtggaaccaatactcatatgtatgacatg
ttaattaaattaacagttcagtggatttattctataattccattcaataaattaaatgaa
tcaccagttcacccagaaaccctaaaatatataagaaaaataaatattggtatagaattc
actcaatcaatattttatataataaattcaaataataaagttgatttgatagttttggca
aatcctttatatcagaaattggttgatttaagttcattaaatatttcgtttgttaatgat
gcagcaagtttttgtaaagaaataaaagatggcggtagtgataataatttatttattatt
ttaatgaaaagattaggtggtattgaatttattaaagaagcatataaacaattaacagat
ttatcaaatggatacatagatgaattttgttattatgagaaattattactttcaagtctt
tcaaaacaacaacaaaatgaaattcaaatctttattgaccacctaaaatatttaatgaaa
ggaaatcaaatatggtcaaccaaaacaataagatatgcaacggaagatcatccaattatt
caattaagaaattcaactaataaattaattgaaaataatattaatatggataaagtatca
ttaacaaataaaaactatatttaa

DBGET integrated database retrieval system