KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0281641
Entry
DDB_G0281641      CDS       T00245                                 

Gene name
polD2
Definition
(RefSeq) DNA polymerase delta subunit 2
  KO
K02328  DNA polymerase delta subunit 2
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
ddi03430  Mismatch repair
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0281641 (polD2)
   03410 Base excision repair
    DDB_G0281641 (polD2)
   03420 Nucleotide excision repair
    DDB_G0281641 (polD2)
   03430 Mismatch repair
    DDB_G0281641 (polD2)
   03440 Homologous recombination
    DDB_G0281641 (polD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0281641 (polD2)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0281641 (polD2)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    DDB_G0281641 (polD2)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      DDB_G0281641 (polD2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     DDB_G0281641 (polD2)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N fn2
Other DBs
NCBI-GeneID: 8623163
NCBI-ProteinID: XP_640553
dictyBase: DDB_G0281641
UniProt: Q54TN8
Position
3
AA seq 521 aa
MFEEINHDNESLIELFKRIEKIETKFKQTKKSYGKDKNFGLDQDYKTTERLDVIIHHNKE
RFLEKQPNSTIKSIHKNDDNKNGDGGGGATTSLVIGQHSNLQYSSIYASRLEKLNPILVE
NVESKYPGIPTQKILHMKPGDECIMIGTLYKEMELKPNILKAYAQDRAMLPIPDNRESFI
GEKDKLFFEDNTGRVKLIGSKEMVDSLVTGLNVAILGKGLPDAEFEVRDIVFPGIPPQPH
SRDLESLKDDAYICLISGLNVGDANNIFQTQLLMDYLQGNLVDNGSDLLGKICKVLFVGN
SIHKENEPIEAFVRYSSKSEIQAKQAKKAIPIKDLDGFLCELCQTVPVDIIPGPNDPTNI
SLPQLPLNSCLFPFSIQNTNLTTCTNPYQSQIGGRLLLGTSGQNIENASRYMTYENKMSL
TESTLIWRHLAPTAPDTLTCAALDNDPFVIEQCPDIYFVGNQDHFETKLLKGPNDEIVRL
IFIPNFSETNTIILVNLKTLDTFPIHFNTTSFFPQSPSTEQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtttgaagaaattaatcatgataatgaatcattaattgaattatttaaaaggattgaa
aaaattgaaactaaattcaaacaaacaaagaaatcatatggtaaagataaaaattttgga
ttagatcaagattataaaacaacagagagattagatgttatcattcatcataataaagaa
agatttttagagaaacaaccaaattcaaccataaaatcaattcataagaatgatgacaat
aaaaatggtgatggtggtggtggtgcaaccacatcattagtaataggtcaacatagtaat
cttcaatatagttcaatttatgcgagtagattagagaaattaaatccaatattagtagaa
aatgttgaatctaaatatccaggtataccaactcaaaagattttacatatgaaaccaggt
gatgaatgtattatgattggtactttatataaagaaatggaattaaaaccaaatatttta
aaagcatatgctcaagatagagcaatgttaccaataccagataatagagaatcatttatt
ggtgaaaaagataaattattttttgaagataatacaggtagagttaaattaattggtagt
aaagagatggttgatagtttagttacaggtttaaatgttgcaatattagggaaaggttta
ccagatgcagaatttgaagttagggatatagttttcccaggcataccaccacaaccacat
tcaagagatttagagtcattgaaagatgatgcatacatttgtttaatttcaggtttaaat
gttggtgatgcaaataatatatttcaaactcaattacttatggattatctacaaggtaat
ctagttgataatggtagtgacttacttggaaagatttgtaaggtattgttcgttggtaat
tcaattcataaagagaatgaaccaattgaagcatttgttagatatagttccaaatcggaa
atacaggcaaaacaagcaaaaaaagcaataccaattaaagatttagatggatttttatgt
gaactttgtcaaacggttccagtggatatcatacctggtccaaatgatcccaccaatatt
tcattaccccaattacctttgaatagttgtttattcccattctcaattcaaaatacaaat
ttaacaacttgcaccaacccatatcaatcacaaatcggtggtagattattgttgggtaca
agtggtcaaaatattgaaaatgcttcacgttatatgacatatgaaaataaaatgtcatta
acagagtcaactttaatttggagacatttagcaccgactgctccagatactctaacttgt
gcagctttagataatgatccattcgtaattgaacaatgtcctgatatttactttgttggt
aatcaagatcattttgaaactaaacttttaaaaggtccaaatgatgaaatcgttcgttta
attttcattccaaatttctctgaaacaaatacaatcattttagtaaatttaaaaacttta
gatacattcccaattcattttaatacaacttctttttttccacaatcaccatcaactgaa
caataa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285381
Entry
DDB_G0285381      CDS       T00245                                 

Gene name
polD1
Definition
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
ddi03430  Mismatch repair
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0285381 (polD1)
   03410 Base excision repair
    DDB_G0285381 (polD1)
   03420 Nucleotide excision repair
    DDB_G0285381 (polD1)
   03430 Mismatch repair
    DDB_G0285381 (polD1)
   03440 Homologous recombination
    DDB_G0285381 (polD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0285381 (polD1)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0285381 (polD1)
Enzymes [BR:ddi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DDB_G0285381 (polD1)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    DDB_G0285381 (polD1)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      DDB_G0285381 (polD1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     DDB_G0285381 (polD1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol RNase_H_2 DNA_pol_B_2
Other DBs
NCBI-GeneID: 8625091
NCBI-ProteinID: XP_638283
dictyBase: DDB_G0285381
UniProt: Q54N97
Position
4
AA seq 1104 aa
MKRSIVTGGGNNDKKFKAQPPPKNNYRGGGDDEEDDEFEEDDDEDEGDEFGEEEDEDDID
VENIIASDSMDIDIQDDGSQQLFLWSRKPVQDLVPHKKPLIFQQLEVDYTEIKEPVPGMP
GPKVGPLPAIRLFGVTKEGNSVLCKVHGFLPYFFISCPPGFTEADCKSLKHDLNESMKMS
SNQSNEKDIENIVVSIDIEKKKSIMGYNPNPLSDFIRITLILPKFVTRCREIFESGRHHF
TIPGQPFRQYQTYESNILFALRFLIDKGITGCSWIELPANTYKLSETPVSTCQIEVDTSL
ETIISLSDDDSPAPYRILSFDIECAGRKGVFPEPEKDPVIQISNIVKNNGDAEPFIKNIF
TLKGCSSIVGAHVIPHKREEDLLREWRKFVIKVDPDVIIGYNIVNFDIPYLISRARQLKI
PEFALLGRIKTTISKIKSTRFSSSNLGTRESKEISMPGRTQFDLMQAIQRDHKLTSYSLN
NVSAHFLKEQKEDVHFSIISDLQNGTDDDRRRLAVYCIKDAVLPMRLLDKLMILINYTEM
ARVTGVPLSYLLGRGEGIKVLSQLYRKAMVENFLIPTYKVTGKGEKFQGAIVIEPTPGFY
DTPIATLDFTSLYPSIMMAHNLCYSTLLSAEEAKKLPPEIYTTTPFGDHFIKSDTKKGLL
PRILEELLSARKKAKDELKNEKDPFKRAVLDGRQLALKISANSVYGFTGARVGKLPCLEI
SRSVTSFGREMLDKTKKIVEERYTIANGYKHDAVIIYGDTDSVMVKFGVKTVAEAMEMGR
DAAKFVTTTFIRPINLDFEKVYYPYLLMAKKKYAGLYWTKPDIHDRMDVKGLEMVRRDTC
LLVRNVVSTILKKILIEKDLKSAEEYTKSVISDLLQNRLDLSMLVITKALSKTQYKGKVI
HNELARKMRARDPATAPNLGDRVPYVVIQGSKGAPIYEKAEDPLYALEHNILLDCQYYLD
KQLKAPLIRIFKPIMSNPDLIFHGEHTRTIAQSTLSDNNKGFFGTLKKKKVCMNCPKELT
DTESTTCINCQHKEASLYQTSLEKVTSLETKFSEAWTQCQRCSGSLHQPVLCSNRDCPIF
YMRTKVQLDLIEAKKTLNRFNVEW
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgaaaagatcaatagtaacaggtggtggaaataatgataaaaaattcaaagcacaacca
ccaccaaagaataattatagaggtggtggtgacgatgaagaggatgatgaatttgaagag
gacgatgacgaagatgaaggagatgaatttggagaggaagaagatgaagatgatatcgat
gttgaaaatataatagcaagtgattcaatggatattgatattcaagatgatggatcacaa
caattatttttatggtcaagaaaacctgttcaagatttagtaccccacaagaaaccatta
atctttcaacaattagaagtagattatacagagattaaagaaccagtaccaggtatgcca
ggtccaaaagttggaccattaccagcaattcgtttatttggtgtcacaaaagaaggtaat
agtgttttatgtaaagttcatggtttcttaccttactttttcattagttgtcctccaggt
ttcactgaagcagattgtaaatctttaaaacatgatttaaatgaatcaatgaaaatgtca
tcaaatcaaagcaatgaaaaagatattgaaaatattgttgtttcaattgatatagagaaa
aagaaatcaattatgggttataacccaaatcctttatctgatttcattagaattacttta
attttaccaaagtttgttacaagatgtagagaaatttttgaaagtggtagacatcacttt
acaattccaggtcaaccatttagacaatatcaaacctatgaatctaatattctatttgca
cttcgtttcttaattgataagggaattacaggttgtagttggatagaattaccagcaaat
acatataaattatcagaaacacctgtttcaacatgtcaaattgaagttgatacatcatta
gaaacaattatatcacttagtgatgatgattcaccagcaccatatagaattttatcattt
gatattgaatgcgcaggtagaaaaggtgtatttccagaaccagaaaaggatccagttatt
caaatttcaaatattgtaaaaaataatggtgatgcagaaccatttataaagaatattttc
acattgaaaggttgttcaagtattgtgggagcacatgtaattcctcataaaagagaggaa
gatttgttaagagaatggagaaagtttgtaattaaagtggatccagatgttatcattggt
tataatattgtaaatttcgatattccctatttaattagtagagcaagacaattgaagata
ccagagtttgcacttttaggtagaattaaaaccaccatatcaaagattaagagcactcgt
ttctcaagtagtaatttaggtacaagagagagtaaagaaatttcaatgccaggtagaact
caattcgatctaatgcaagcgattcaaagagatcacaaactaacaagttattcactcaat
aatgtatcggctcattttttaaaggagcaaaaggaggatgttcatttttcaattatctct
gatcttcaaaatggtacagatgatgatcgtagaagattggcagtctattgcataaaagat
gccgtattaccaatgagattattggataaattgatgattcttatcaattacacagagatg
gctcgtgtaactggtgttccattaagttatttgttgggtcgtggtgaaggtatcaaagtg
ctatcccaactttatcgtaaggccatggtagagaatttcctcattccaacttataaagtc
actggtaaaggtgaaaagtttcaaggtgccatcgttattgagccaacaccaggtttctat
gatactccaattgcaacactcgatttcacttcactttatccatcaattatgatggctcat
aatctttgttattccactttgttatcagcagaggaggcaaagaaattaccaccggaaatc
tatacaaccactccatttggtgatcattttataaaatcagatacaaagaaaggtttactt
ccaagaattctcgaggagttattgtctgcaagaaagaaagcaaaagatgaattaaagaat
gaaaaagatccattcaagagagcagtgttggatggtagacaattggcattgaaaatttca
gcaaattcagtttatggtttcactggtgctcgtgttggtaagctaccatgtcttgagatt
tctcgttccgtaacttcatttggtagagaaatgcttgataagacaaagaagatcgtagag
gaacgttatactatcgccaatggttataaacatgatgccgtaattatctatggtgataca
gattcggtaatggttaaatttggtgtaaagaccgtcgcagaggcaatggaaatgggtaga
gatgctgccaagtttgtaactaccacttttattcgtccaattaatttagattttgaaaag
gtttattatccttatcttttaatggccaagaaaaagtatgccggtttgtattggacaaaa
ccagatattcacgatagaatggatgtcaaaggtttggaaatggttcgtagagatacttgt
ctattggttagaaatgtcgttagtactatccttaaaaagattctcattgaaaaggattta
aaatctgccgaagaatatacaaagagtgtcattagtgatctcttacagaatcgtttagat
ctttcaatgttggtaattacaaaagctctctcaaaaactcaatacaaaggaaaggtaatc
cataatgaattggctagaaaaatgagagctagagatccggcaacagctccaaatttaggt
gatcgtgtgccttatgtggtcattcaaggctcaaagggtgcaccaatctatgagaaagct
gaagatccactttatgctttggaacataatatccttttggattgtcaatactatttggat
aaacaattgaaagcaccattgattcgtattttcaaaccaattatgtcaaatcctgattta
attttccatggtgaacatactagaaccattgctcaatcaacactcagtgataataacaaa
ggtttctttggtactttgaaaaagaaaaaagtctgtatgaattgtccaaaggaattaact
gatacagaatctacaacttgtataaattgtcaacataaagaagcctctctctatcaaacc
tctttggaaaaagttacaagtttagaaactaaattctctgaagcttggactcaatgtcaa
cgttgttctggtagtttacatcaacctgtactttgttcaaatcgtgattgtccaatcttt
tatatgagaactaaagttcaattagatcttattgaagcaaagaaaactttaaatagattt
aatgttgaatggtaa

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0294609
Entry
DDB_G0294609      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K03504  DNA polymerase delta subunit 3
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
ddi03430  Mismatch repair
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0294609
   03410 Base excision repair
    DDB_G0294609
   03420 Nucleotide excision repair
    DDB_G0294609
   03430 Mismatch repair
    DDB_G0294609
   03440 Homologous recombination
    DDB_G0294609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ddi01009]
    DDB_G0294609
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0294609
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0294609
Protein phosphatases and associated proteins [BR:ddi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DDB_G0294609
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    DDB_G0294609
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      DDB_G0294609
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     DDB_G0294609
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 8622184
NCBI-ProteinID: XP_001732994
dictyBase: DDB_G0294609
UniProt: B0G131
Position
3
AA seq 697 aa
MSTTETVQTILDCLKKTVLEEGNSVNYRWISDQFKIHPDVSKEILSYFYNKNKDVISPIF
VLSGVLKEHPNVITFILASNDSLESSKQKFKSLFSENIYSISNGKSLPKDPLNVIQLSYI
AFKDRYRNIVALGSDYFNKQIPIKSKTFKKKELKRALPIAVEPTPYRHQALPKPAILPIT
SAPIGAKKPAATTQGSLNSFFSKTADDGKSGNEAKVSLFSMFTKDEPKSSTPSVKKEDTT
KKSKNISTSSSSSKKAAAKKKDSGSINSIIKKKKRSSSDSEDESENSEDDIKLPSYKRNK
KIIHNDSDDSDKEEEEEEEEEKGPSFISKKRQLSSSSDSEDNHSDNESEQNIKKQKLEKE
QQLEKERLEKEKKEKLEKEKKEKLEKERLEKEKLEKEKKEKLEKEKLEKERLEKEKLEKE
KKEKLEKEKKEKEEKERLKKEKENLEKLKSKSKSPSKETSKKEKTIFVKEEEKEVKKEKE
EKEVKKEKEEKEEEEEEEVIEKPIKKKSSTPIPTPTKSSQNKSSSTPTKSPIQKKKSIIK
QESDEEMKDQEQEDEEEQEEEVIKTKRPVKKNKTIVESSDDEEEKEKEKEKEKEKQVKSP
KLSKNATITSSIVKPAAPVVKQRAATSPKSKVKEEPVKKEKDEDQEEKEEEEEPVAEKKT
KSKSSPKKPTASKSKKKAAPEPDKKQTNIMSFFAKKE
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgtctacaacagaaactgttcaaactatattggactgtttaaaaaagacagttttagaa
gaaggtaattcagtaaattatagatggatttctgatcaatttaaaattcatccagatgtc
tcaaaagagatattatcatatttttataataaaaataaagatgtaatctcaccaatattt
gtattatcgggtgtattaaaggaacatccaaatgtaataacatttatactagcatcaaat
gatagtttggaaagttcaaaacaaaaatttaaatcattatttagtgaaaatatttatagt
atttcaaatggtaaatcgttaccaaaagatccattaaatgttatccaattaagttatata
gcatttaaagatagatataggaatattgttgcattaggttctgattattttaataaacaa
ataccaataaaatcaaaaacatttaaaaagaaagaattaaagagagcattaccaattgca
gttgaaccaacaccatatagacatcaagcactaccaaaaccagcaattttaccaataaca
tcagctccaattggtgcaaagaaaccagcagcaacaacacaaggatcattaaatagtttc
ttttcaaaaacagcagatgatggaaaatctggaaatgaagcaaaagtttcacttttttca
atgtttacaaaagatgaaccaaaatcatcaacaccatcagttaaaaaagaggatacaact
aaaaaatcaaagaatatttcaactagtagtagtagtagtaaaaaagcagctgctaaaaag
aaagactctggtagtatcaattcaattattaaaaagaaaaagagatcatcttcagatagt
gaagatgaaagtgaaaatagtgaagatgatataaaattaccaagttataaaagaaataaa
aaaatcattcacaatgatagtgatgatagtgataaagaagaagaagaagaagaagaagaa
gaaaaaggaccatcattcatctctaaaaaaagacaactatcatcatcatccgatagtgaa
gataatcatagtgataatgaatcagaacaaaatattaaaaaacaaaaacttgaaaaagaa
caacaattagaaaaagaacgtttagaaaaagagaaaaaagaaaaattagaaaaagagaaa
aaagaaaaattagaaaaagaacgtttagaaaaggagaaattagaaaaagagaaaaaggag
aaattagaaaaagaaaaattagaaaaggagagactagaaaaagaaaaattagaaaaagag
aaaaaggagaaattagaaaaagagaaaaaagaaaaagaagaaaaagaacgtttaaaaaaa
gaaaaagaaaatttagaaaagttaaaatcaaaatcaaaatcaccatcaaaagaaacctct
aaaaaagaaaaaactatttttgtaaaagaagaagaaaaagaagttaaaaaagaaaaagaa
gaaaaagaagttaaaaaagaaaaagaagaaaaagaggaagaagaagaagaagaggtaatt
gaaaaaccaattaaaaagaaatcttcaactccaattccaactccaaccaaatcctcacaa
aataaatcatcttcaactccaactaaatcaccaattcaaaagaaaaaatcaataattaaa
caagaaagtgatgaagaaatgaaagatcaagaacaagaggatgaagaagagcaagaggaa
gaggtaatcaaaacaaagagacctgtaaagaaaaataaaacaattgttgaaagtagtgat
gatgaggaagaaaaggaaaaagaaaaagaaaaagaaaaagaaaaacaagttaaatcacca
aaattatcaaaaaatgcaactatcacatcttcaattgttaaaccagctgctccagttgtt
aaacaacgtgctgcaacttcaccaaaatcaaaggttaaggaagaaccagttaaaaaggaa
aaggatgaagatcaagaagagaaagaagaagaagaagaacctgttgcggaaaagaaaaca
aaatctaaatcctctccaaagaaacctactgcctctaaatccaaaaagaaagcagcacct
gaacctgataaaaaacaaacaaatatcatgtcttttttcgctaaaaaagagtaa

DBGET integrated database retrieval system