KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0282997
Entry
DDB_G0282997      CDS       T00245                                 

Gene name
rad54
Definition
(RefSeq) CHR group protein
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:3.6.4.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0282997 (rad54)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0282997 (rad54)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     DDB_G0282997 (rad54)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     DDB_G0282997 (rad54)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII Dicty_REP TusA
Other DBs
NCBI-GeneID: 8623874
NCBI-ProteinID: XP_639303
dictyBase: DDB_G0282997
UniProt: Q54RP8
Position
4
AA seq 931 aa
MKRSLAPSAIYENKKLKYDLPDIVETTPDDSDKGKRGRKKAPIPTVNHLEKYSIKKKVEL
KDEDNKSDDGSVSSGSSNGDKIREETKKGKNQRMNPDSDPYYFLIKYKNTTKNDEEDGLG
ILILYYDQAIVQSIEGRQIGKTGLTRSNDDDDDGKGQYQKVMIKKKEVYFQEDFAMAIGN
KWIKIILSVGEEEFKNGSIFLKTDSIIKKKKEEKKEKKAPILAAAHRPKGFQVPVKGLEK
AVRLSKPLHNPLAPNSLVLFTPVDITGENRIHCVVDPILSQKLRPHQREGVQFMFDCLLG
FRGGFKGNGCILADDMGLGKSIQAITILWTLLKQGPKGESTAKKAVIVAPCTLVGNWGQE
LKKWLGDGVNTVAIGESTKTGRAKLTELEFGKADVLIISYDQLRIYCEDICKITSIGLVI
CDEGHRLKNAEIKTTKAVSMIPTARRVILSGTPIQNDLTEFYAMVNFVNPGVLKNVATFK
NVYDAPIVASRNPDASDEEKEIGRQRSLELSRLTSQFILRRTAFVNTQYLPPKVEYVIFC
KLTPLQLSIYKHLIKEAKDSAFASTTGALPLITTLKKLSNCAELVYTPDKETDVGTSILK
LFPKEWNPKVFQPQYSSKLLFVDRLLANIRNSKSGDKTVIISNYTQTLEVLATMCKTRGY
AYFQLDGSTANAKRQQLVNLYNDPARPEFVFLLSSKAGGVGLNLIGGNHLVLFDADWNPA
NDAQSMARVWREGQKKIVSIYRTFTTGTIEEKIFQRQLTKQALSTSITEGDSDNSPSFDS
KDLKDIFTLREDTLCDTHDMLSCKCAPTVGGKIPKHKRDTMSISELNSWHHFHQMEKIKD
QKVASACQDIATFVFVNDKGPVDKNKSKEKTSNTTTTTTTTTSTSTSKSEKSSPPPSSSK
HKKKIIEESSDEDDDTPDEASSDESYNSDSD
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgaaaagaagtttagcaccaagtgcaatttatgaaaataaaaaattaaaatacgattta
ccagatatagttgaaacaactccagatgatagtgataaaggtaaaagaggtagaaagaaa
gcacctataccaacagttaatcatttagagaaatattcaataaagaaaaaggttgaatta
aaagatgaagataataaaagtgatgatggtagtgttagtagtggtagtagcaatggtgat
aaaattagagaagaaacaaaaaaaggtaaaaatcaaagaatgaacccagattctgaccca
tattactttttaattaaatataaaaatacaacaaaaaatgatgaagaagatggtttaggt
attttaatattatattatgatcaagcaattgttcaatcaattgaaggtagacaaattggt
aaaactggtttaacaagaagtaatgatgatgatgatgatggcaaaggtcaatatcaaaaa
gtaatgattaaaaagaaggaagtttattttcaagaggattttgcaatggcaattggtaat
aaatggataaagattattttatcagttggtgaagaagagtttaagaatggttcaatcttt
ttgaagacagatagtattataaaaaagaaaaaagaggaaaaaaaagaaaaaaaggcacca
attctagcagcagctcatagaccaaaaggatttcaagtaccagtgaagggattggagaaa
gcagtacgtctttccaaaccattacataacccattggcacccaattcattggtattgttt
acaccagtcgatatcactggtgagaatagaattcattgtgttgtagatcctatattatca
caaaaacttagaccacatcaaagggagggtgttcaattcatgtttgattgtttgttggga
tttagaggtggtttcaaaggtaatggttgtattttagccgatgatatgggtttgggtaaa
tcaattcaagcgatcactatcctttggacactcttaaaacaaggtcctaagggtgaatcg
actgcaaagaaggctgtaatcgttgcaccatgtactttggttggtaattggggtcaggaa
ttaaagaaatggttaggtgatggtgtaaatacggttgcaattggtgagagtacaaaaaca
ggtcgtgccaaattgacagagttggaatttggtaaagcagatgtactcatcatttcctat
gatcaacttcgtatctattgcgaggatatttgtaagattacatcgattggtttggtaatt
tgtgatgaaggtcatcgtttgaaaaatgcagaaattaaaaccaccaaagcagtatcgatg
ataccaacagctcgtcgtgttattctctctggtacaccaattcaaaatgatttaaccgaa
ttttatgcaatggttaatttcgttaatcctggtgtattgaaaaatgttgcaacctttaaa
aatgtttatgatgctccaattgttgcctcgagaaatccagatgcttccgatgaagagaag
gagattggtcgtcaacgttctttagagttgagtagattaactagtcaattcattttacgt
agaactgcatttgtaaatactcaatatcttccaccaaaggtagaatacgttatcttttgt
aaacttacacctcttcaactttcaatctataaacatctcattaaagaagcaaaagattct
gcatttgcatcgacaactggtgccttaccattaattaccacattgaaaaagttatcaaat
tgtgcagagttggtttacacacccgataaagagacagatgttggtacctccatattaaag
ttattcccaaaggaatggaatccaaaagttttccaaccacaatactctagtaagttattg
tttgtagatcgtttacttgcaaatattagaaactcaaaatctggtgataaaactgtaatc
atttcaaattatactcaaaccttggaagtattggcaacaatgtgtaaaactcgtggttac
gcatactttcaattggatggttcgacagccaatgctaaacgtcaacaattggtcaatctt
tataatgacccagccagaccagagtttgtatttcttcttagttcaaaagcaggtggtgtt
ggtttgaatcttattggtggtaatcatttggttttattcgatgcagattggaatccagca
aatgatgcccaatctatggctcgtgtttggagagaaggtcaaaaaaaaatcgtatccatt
tatcgtacctttacaactggtaccattgaagagaaaatctttcaaagacaattaaccaaa
caagcactttcaacaagtatcactgaaggggattctgataattcaccatcttttgactca
aaggatttaaaagatatttttacacttcgtgaagatacactttgtgatactcatgatatg
ttaagttgtaaatgtgcacctactgttggtggtaaaatcccaaaacataaaagagatacc
atgtctattagtgaacttaattcatggcatcatttccatcaaatggaaaaaattaaagat
caaaaagttgcttcagcatgtcaagatattgcaacatttgtttttgtaaatgataaaggt
ccagttgataaaaacaaatcaaaagaaaaaacttcaaatactactacaactactacaact
accacttcaacttcaacttctaaatctgaaaaatcatcaccaccaccatcttcatcaaaa
cataagaaaaaaattattgaagaatcaagtgatgaagatgatgatacaccagatgaagct
tcaagtgatgaaagttataattctgatagtgattag

KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0285117
Entry
DDB_G0285117      CDS       T00245                                 

Gene name
rad54b
Definition
(RefSeq) CHR group protein
  KO
K10877  DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0285117 (rad54b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0285117 (rad54b)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     DDB_G0285117 (rad54b)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     DDB_G0285117 (rad54b)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C DUF2439
Other DBs
NCBI-GeneID: 8624946
NCBI-ProteinID: XP_639875
dictyBase: DDB_G0285117
UniProt: Q54NP1
Position
4
AA seq 989 aa
MKKSSKGFVSPYKDSNTTSTPSINHLASKPKKITTSTTSTTSTTTTSSSSSPIETQKTKS
KANSSSNNNDKSEDKTNDGELIHYKIGWCAKSTKKHKIYNDGYLMYDQDKKIFTLYDDCG
KENGKSVTVNIQDVKPDTKVFISSKEVLIEHIITSKEFEKATGLESSLVSNSTSSSSLST
TTIRKLSKKQQKLQEEEEEKQQQQQDEKQTTNINKSTIKKEFKSHTSLEEQKSSKKIVCP
HDPNSKDALIFYSPPPSQLDEEGNKVVHVVLDPYIGRHLRPHQRRGVKFLYDCVTGNSND
NGYSGAILADQMGLGKTLQTLALLWTLLKQSPYGKPTIKKAIIVTPSTLVNNWKSEIQKW
FGNGRLIASTLTDSLTKETKANLNDFNTSIKPVLIISYEQCRIFSKELETMSCGLMVCDE
AHRLKNSNAKTTQSIMSVRCDRKILLTGTPIQNNLVEFYSMMDFANPNCLGSLADFKKSF
IIPINKSRESPNSTSTSEGIRKSIQLSKLVKPFIIRRKSNILEKYLPPKRVQIIFCKLSS
LQIELYKSILNSNSVKSLLSGGGSRGSATSLSTITLLKKLCNSPSLLLLNNKQDEGGEQQ
QTEIQNILKKHNYTLENYQEIQEQQDNESGKLLFVESLIKQLKPMNEKLVLVSNFTKTLD
VFERLCKRLSIDTLRLDGDVKADSRQALVDKFNSSTQNVSSSKSSSSQYQVFLLSAKAGG
VGINLIGGNHLVLYDPDWNPAIDIQAMERIWREGQTKPVFIYRLFSTGTIEEKIYQRQLM
KESISNSIVDKKFNDNGGNFSLEDLKDIFSYNENTNSDTHDLLQCNCGNSNSNASTSINI
KRIEIFKTIQHLDKWEHYRDVDQFSKQCNHDSILKKLKSKQDPISFIFISKTPIPSNNDL
DDDQNDDDDFSFLEVENQIEDEEEDNNQQNTTPSKKRSNKKKEVDEEEEQEEEGEEEEET
NPQTNLRKRAKINIVEDNDDDDLSDLDMS
NT seq 2970 nt   +upstreamnt  +downstreamnt
atgaaaaaaagtagcaaaggatttgtttcaccttacaaagattcaaacacaacatcaact
cctagcattaatcatttagcatcaaaaccaaaaaaaataacaacatcaacgacatcaaca
acttcaacaacaacaacatcatcatcatcatctcctatagaaacacaaaaaacaaaatcg
aaagcaaatagtagtagcaataataatgataaaagtgaagataaaactaatgatggagaa
ttaattcattataaaattggttggtgcgcaaaatcaactaaaaaacataagatttataat
gatggttatttaatgtatgaccaagataaaaaaatatttacattatatgatgattgtggt
aaagagaatggaaagagtgtaacagtgaatatacaagatgttaaaccagatacaaaagta
ttcatctcttcaaaagaagtattaattgaacatataattacaagcaaagaatttgaaaaa
gcaactggtttagagtcatctttagtttcaaattctacatcatcatcatcactatcaaca
acaacaattagaaaactaagtaaaaaacaacaaaaacttcaagaagaagaggaggaaaaa
caacaacaacaacaagatgaaaaacaaacaacaaatattaataaatcaacaattaaaaaa
gaatttaaaagtcatactagtttagaagaacaaaaaagttcaaaaaagattgtttgtcca
catgatccaaattcaaaggatgcattaatattttattcaccaccaccaagtcaattggat
gaagaaggtaataaagttgttcatgttgtattggatccatatattggtagacatttaaga
cctcatcaaagaagaggtgttaaattcctttatgattgtgttacgggtaattcaaatgat
aatggatacagtggtgctattttagctgatcaaatggggttaggtaaaacattacaaact
ttagctttactttggacattattgaaacagtcaccatacggcaaaccaacaataaaaaag
gctatcatagttacaccatcgacattggttaacaattggaagagtgaaattcaaaaatgg
tttggcaatggtcgtttgattgcatcaactttaacagattcattaacaaaagagacaaaa
gcaaatttaaatgatttcaatacatcgattaaacccgtattaattatctcttatgaacaa
tgtagaatcttttcaaaggaattggaaacgatgagttgtggtttaatggtttgtgatgaa
gctcatcgtttaaagaattcaaatgcaaagaccactcaatcgataatgagtgttagatgt
gatagaaagattttattaacaggtacaccaattcaaaataatttagtggaattttattca
atgatggattttgctaatccaaattgtttaggttctttagctgactttaaaaaatcattc
atcataccaattaataaatctagagaatcaccaaattcaacttcaacttcagaaggtatt
agaaaatcaattcaactctcaaaattggttaaaccattcatcattagaagaaaatcaaat
attttggagaaatatttaccaccaaaaagagtacaaatcatattttgtaaattatcatca
cttcaaattgaattatataaatcaattttgaattcaaatagtgttaaatcattattatca
ggtggtggtagtagaggttcagcaacttctctttcaacaataacattattaaagaaatta
tgtaattcaccatcattattattattaaataacaaacaagatgaaggaggagaacaacaa
caaactgaaattcaaaatatattaaagaaacataattatacattagaaaattatcaagag
attcaagaacaacaagataatgaatctggtaaattattatttgttgaatcattgattaaa
caattaaaaccaatgaatgaaaaattggtattggtttcaaatttcacaaaaacattggac
gtctttgagagattatgtaaacgattatcaattgatacacttagattggatggtgatgtt
aaagctgattcaagacaagcattggttgataaatttaattctagtactcaaaatgtttca
tcatcaaaatcatcgtcatcacaatatcaagtgtttttgttatctgcaaaagctggtggt
gttggtattaatttaattggtggtaatcatttggttctatatgatccagattggaatcct
gcaatcgatattcaagcaatggaaagaatttggagagaaggtcaaactaaaccagttttc
atctatagattattttcaacaggtacaattgaagagaagatttatcaaagacaattaatg
aaagaatcaatttcaaattcaattgttgataaaaagtttaatgataatggtggtaatttc
tcattggaagatttaaaagatatcttttcttataatgaaaatacaaattcagatactcat
gatttattacaatgtaattgtggtaatagtaatagtaatgctagtactagtataaatatt
aaaagaatagaaatatttaaaactattcaacatttagataaatgggaacactatagagat
gtagatcaattttcaaaacaatgtaatcatgattcaatattaaagaaattgaaatcaaaa
caagatccaatttcttttattttcatttctaaaacaccaataccatcaaataatgattta
gatgatgatcaaaatgatgatgatgatttttctttcttagaagtagagaaccaaattgaa
gacgaagaagaggataataaccaacaaaataccacaccatcaaagaaaagatcaaataaa
aagaaagaagttgatgaggaggaggagcaggaggaagaaggagaagaagaagaagagaca
aatcctcaaaccaatttaagaaagagagcaaaaataaatattgttgaagataatgacgat
gatgatttgtcagatttagacatgtcataa

DBGET integrated database retrieval system