KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0283857
Entry
DDB_G0283857      CDS       T00245                                 

Gene name
lig3
Definition
(RefSeq) BRCT domain-containing protein
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DDB_G0283857 (lig3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0283857 (lig3)
Enzymes [BR:ddi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DDB_G0283857 (lig3)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     DDB_G0283857 (lig3)
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C LIG3_BRCT BRCT_2 BRCT PTCB-BRCT RNA_ligase mRNA_cap_enzyme
Other DBs
NCBI-GeneID: 8624245
NCBI-ProteinID: XP_638847
dictyBase: DDB_G0283857
UniProt: Q54QM4
Position
4
AA seq 1175 aa
MSEDKSGSFYSMYKLCGQLEKESSHSGKTQLIKSFCNVFKGDLYLLAKLMLCKEDKRVFR
IKDKAMLKICSHIWDCDLDDMIEDLDNGDFTETCKKFYIEYGKYPEKSTLTLKEVDQVLD
SLTVSGKFEDQVKIINKLLKRCTPFDFRLVCRIIDSDLKINTGAKFFLDAFHPQAYDAFK
KANNLKGVIEKIQQHDFDNDNGDGDDGDGDDNDDDDGDGDSDSDKKKKKSSGGSGSDSGS
KKKSKSFEVAIKLMTPIKPMLPKAVKTVEGVVKSSECFYAEIKYDGERIQIHKDGNQFSC
YSRNLKPLMPWKVDEVKPYIPKSTKAQQMILDGEILLMDTKTSQPLPFGTLSAHKKNGFK
DATVCVFLFDILYLNGKSLIHLPLKERREILEKNVMVVKNRIEFSEVTIVNGASEKSKLT
ALLNRVFKEKLEGLVIKDAMSEYEPGCRHWIKIKKDYIHGMADSADLIAVGGYYGSGSMG
GLVTVFLMVCYDKQNKIYKTVVKASGGLDDNMIAKLQPKVTSTMTKISKEVSKIPYWLDC
PKQYAPDFIVKDIKQAMIFEIESAEFTKSDHHTTGYSMRFPRILKIRHDKDYKTATTLEE
LVEIGKDIKIVPVGKGDNNSPTTTTTTTTTTTTTTSSKLIKKQQLSDDDDDNDKDSKQQQ
QEPSKLKFVSDDLLDPFNDKSDDESNKIFILNYVDNSGIWNEKGLSGAIGKKWPSIPKSF
SQGDSNIIKSGEIRVEKVKDDSISTNKKVFICNLSCIIPPKSKKESYTFSLKEFKSAIKE
AKGAINQKKASVHLAKPQFTSPSWSELDEVLTKELYNSGIKVFVHSISKSSPTTTSPTTT
SPTTTSPKITSPSSSSSPSNKLSPLKRGRDEKLEHEIIKDIEPSLPIFEDVNAVIDSKTI
DQVDVKRLINSIKTMGGRVSDKWQQVGIGKTTHLICNGMSDLYLHVDRLGGTIVLPNWVD
QCFGSDKLLPLHEDYIYFNKKDHPDYSQSSSSSSMSIEEEKIVVTTTSDDPSEGNQQQQD
KKVIKESKIIQSKDHSSTTTIDTKITITSTNNNNNGNDNNKTRKKQHLLSIFQECIIFLH
DNVNDRETLKRYIIAYGGDISDSVNDKTTHLVASLPNNFSNVKPKDLFKSIINNNSKNNN
NNNNNNNNGIIVNSLWLWDSINMSDLLDVKNYKLF
NT seq 3528 nt   +upstreamnt  +downstreamnt
atgtcagaggataaatcaggatcattttactcaatgtataaattatgtggtcaacttgag
aaagagtcatcacattctggtaaaacacaattgataaaatcattttgtaatgtttttaaa
ggggatttatatctattagcaaaattaatgttatgtaaagaagataaaagagtatttaga
ataaaagataaggcaatgttaaaaatttgttcacatatttgggattgtgatttagatgat
atgattgaagatttagataatggtgatttcactgaaacttgtaaaaaattttatatagaa
tatggtaaatatccagaaaaaagtacattaacattaaaagaagttgaccaagtattggat
tctttaacagtatcaggtaaatttgaagatcaagtaaaaattataaataaattattgaaa
agatgtacaccattcgattttagattagtttgtagaattattgatagtgatttaaaaata
aatactggtgcaaaattctttttagatgcatttcacccccaagcatatgatgcatttaaa
aaagcaaataatttaaaaggtgtaattgaaaaaattcaacaacatgattttgataatgat
aatggtgatggcgatgatggtgatggtgatgacaatgatgatgatgatggtgatggtgat
agtgatagtgataaaaaaaagaaaaaatcaagtggtggtagtggtagtgatagtggtagt
aagaaaaaaagcaaatcatttgaagttgcaattaaattaatgacaccaattaaaccaatg
ttaccaaaagcagttaaaactgttgaaggtgttgtaaagagtagtgaatgcttttatgca
gagattaaatatgatggtgaacgtattcaaattcataaggatggtaatcagtttagttgt
tattctcgtaatcttaaaccattaatgccatggaaagtggatgaagttaaaccatatatt
ccaaaatcaaccaaagctcaacagatgatattagatggtgaaatacttttaatggatact
aaaaccagccaacctttgccatttggtacattaagtgcccataaaaagaatgggttcaaa
gatgcaacggtttgtgtgttcctattcgatattctatatctaaatggtaagtcattgatt
catttaccacttaaagagagaagagaaatcttggaaaagaatgtaatggtggttaaaaat
cgtattgagttctctgaggtgacaattgttaatggtgcctctgagaaatcaaaattgacg
gcattgttgaacagagtatttaaagagaaacttgagggtttggtaatcaaagatgcaatg
tcagaatatgagccaggttgtagacattggataaaaattaaaaaggattacattcacggt
atggctgatagtgcagatttaattgcagttggcggttactatggttctggttcgatgggt
ggtttggtaacggtttttttgatggtatgttatgataaacaaaataaaatctataaaaca
gtggtcaaagcaagtggtggtttggatgataatatgattgccaaacttcaaccaaaagtc
acaagtacaatgacaaaaatttcaaaagaagtttcaaagattccttattggttagattgt
ccaaagcaatatgcgccagatttcattgtaaaagatattaaacaagctatgatatttgaa
attgagtcagctgaattcactaaaagtgatcatcataccactggttattcaatgcgtttc
ccacgtattctcaaaattagacatgacaaagattataaaactgcaacaacccttgaagaa
ttggttgaaattggtaaagatattaaaattgttccagttggtaaaggtgataataattca
ccaacaactactactacaacaactactacaacaacaacaactacttcatcaaaattaatt
aaaaaacaacaattatcagatgatgatgatgataatgataaagactctaaacagcaacaa
caagaaccatcaaaattaaaatttgttagtgatgatttattagatccatttaatgacaag
tcagatgatgaatcaaataaaatatttatattgaattatgttgataattcaggtatttgg
aatgaaaagggcttatcaggtgcaattggtaagaaatggccatcaatcccaaaatcattt
tctcaaggtgattcaaacattataaagagtggtgaaattcgtgttgaaaaggtaaaagat
gattcaatatcaacaaataaaaaagtttttatttgtaatctttcttgtattatcccacca
aaatctaaaaaagaatcttatactttctcattaaaagaatttaaatctgcaattaaagaa
gcaaaaggtgcgatcaatcaaaaaaaagcttcagttcatttagcaaaaccacaattcact
tcaccatcttggtctgaacttgatgaagtactaacaaaagaattatataatagtggtatt
aaagtatttgtacattcaatttcaaaatcatcaccaactacaacatcaccaactacaact
tcaccaactacaacatcaccaaaaataacatcaccatcatcatcatcatcaccttcaaat
aaattaagcccattaaaaagaggaagagatgaaaaattagaacatgaaatcattaaagat
attgaaccatctttaccaatatttgaggatgttaatgctgtaattgatagtaaaaccatt
gaccaagttgatgtaaagagattaataaattcaattaaaactatgggtggtcgtgtatca
gataaatggcaacaagttggtattgggaaaacaacccatttaatttgcaatggtatgagc
gatctttatttacatgtcgatcgtttaggtggtacaattgttttaccaaattgggttgat
caatgttttggttcagataaattattaccattacatgaggattatatttatttcaataaa
aaagatcatccagattattcacaatcatcatcatcatcctcaatgtcaattgaagaagag
aaaatagtagtaactaccacctctgatgatccatcagagggtaatcaacaacaacaggat
aaaaaggttataaaagaatcaaaaataattcaatcaaaagatcattcttcaacaactact
attgatacaaaaataacaattacttcaaccaataataataataatggtaacgataacaac
aaaactagaaagaaacaacatcttttatcaattttccaagaatgtattatatttttacat
gataatgtaaatgatagagaaactttaaaaagatatatcattgcttatggtggtgatatt
tctgattcagtcaatgataaaactactcatttagttgcttctctaccaaataatttttca
aacgtaaaaccaaaagatctttttaaatcaataattaataataatagtaaaaataataat
aataataataataacaataataatggtataattgtaaattctttgtggttatgggattca
ataaatatgagtgatcttttagatgtaaaaaattataaacttttctaa

DBGET integrated database retrieval system