KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284507
Entry
DDB_G0284507      CDS       T00245                                 

Definition
(RefSeq) hypothetical protein
  KO
K10870  RAD51-like protein 2
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0284507
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0284507
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     DDB_G0284507
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     DDB_G0284507
SSDB
Motif
Pfam: Rad51 ATPase AAA_25 AAA_24 RecA
Other DBs
NCBI-GeneID: 8624628
NCBI-ProteinID: XP_638535
dictyBase: DDB_G0284507
UniProt: Q54PJ7
Position
4
AA seq 381 aa
MDEDINKDTNNNNNTTDSNNNNNNINEDEIIFNNYINNYSNYLNNNGISALDLLIQGRDG
NNNIITFCSEIDQMLNGGTPLKKITEICGVPGIGKTNMAFQLLVNTSIPFDLGGVQGKAI
YIDTEGSYSCQRVREMATHLVNHLECVLLKNPMTQTTYIPTVETVLNSIYYYRVYHYIEI
ISLIHQLPLFLEKNKDVKLIVVDSITYPFRCDFKDMGLRTRSLLSLAQNLMNIATRYNLA
VVVMNQVTTKISPNQKESILVPYLGESWTHICTYRMVLFWKQKQRFCHLYKSPSFKSCFT
PFDIVEYGIRDVGFNHPPPLNPEDQEQEKEKEKRKKKNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNKNNDENEMYIEN
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggatgaagatataaataaagatactaataataataataatacaacagatagtaataat
aataataataatattaatgaagatgaaataatatttaataattatattaataattatagt
aattatttaaataataatggaattagcgcattggatttattgatacaaggtagagatggt
aataataatattattacattttgtagtgagatagatcaaatgttaaatggtggtacacct
ttaaaaaagattacagaaatttgtggtgtacctggtattggtaaaactaatatggcattt
caattattagtaaatacatctattccatttgatttaggaggtgttcaaggtaaagcaatt
tatatagatactgaaggtagttattcatgtcaacgtgtacgtgaaatggcgactcattta
gtgaatcatttagaatgtgtactattaaaaaacccaatgacccaaacaacatatatacca
accgttgaaactgttttaaatagtatctattactatagagtttatcattatattgaaatc
atttcattaattcatcaattaccattattcttagaaaaaaataaagatgttaaattaatt
gtagttgatagtataacatatccttttagatgtgattttaaagatatgggtttaagaaca
agaagcttattgagtttagcacaaaatttaatgaatatagcaactagatacaatttagca
gtggttgtaatgaatcaagttacaacaaagatatcacccaatcaaaaggagtcaatattg
gttccttacttgggtgagagttggacacatatttgtacatatagaatggttttattttgg
aaacaaaaacaaagattttgtcatctttataagtcaccatcatttaaatcttgttttacc
ccttttgatatagttgaatatggtattcgtgatgttggtttcaatcatccacctccttta
aatcctgaagatcaagaacaagaaaaagaaaaggaaaaaagaaaaaagaaaaataataat
aataataataataataataataataataataataataataataataataataataataat
aataataataataataataataataataaaaataatgatgaaaatgaaatgtatatagaa
aattaa

DBGET integrated database retrieval system