KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0284987
Entry
DDB_G0284987      CDS       T00245                                 

Gene name
repG
Definition
(RefSeq) flap structure specific endonuclease 1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0284987 (repG)
   03410 Base excision repair
    DDB_G0284987 (repG)
   03450 Non-homologous end-joining
    DDB_G0284987 (repG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0284987 (repG)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0284987 (repG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ddi04147]
    DDB_G0284987 (repG)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     DDB_G0284987 (repG)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    DDB_G0284987 (repG)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     DDB_G0284987 (repG)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DDB_G0284987 (repG)
Exosome [BR:ddi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DDB_G0284987 (repG)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc tRNA_bind_2 HHH_5 5_3_exonuc_N DUF4142
Other DBs
NCBI-GeneID: 8624889
NCBI-ProteinID: XP_639977
dictyBase: DDB_G0284987
UniProt: Q54NU0
Position
4
AA seq 384 aa
MGIKKLTDLIEDNAPTSIKTNILKNYFGRIIAIDASTSLYQFLIAMNADVSSALTNQLGE
TTSHLQGMFYRTIKLISRGIKPIYVFDGSAPVLKSGELAKRQARRKEAKENLKEATEVGT
NEEVQKFAKRVITVTRKQNEDCIKLLTLMGVPIVKAPCEAEAQCAEIVKKGKAWATGSED
MDSLTLGSTVLLRRLFFSEAKKMPILEFELQSVLEGLGLTQDEFIDLSILLGCDYCDSIK
GIGPKRAIELIQKHKSLEEVIKHLDKSKYPLPEFFPYPEVRELFKNPNVIPADQLPPFQW
KDPDVEGLNKFLVEEMGFSDVRVAQGIEKLKKFKNTSVQSRMDSFITVIKKPEDPNDKKK
KVTKTPSKPSAKTSKKSSSTFKRK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgggaattaaaaaattaacagatttaattgaagataatgcaccaacttcaattaaaaca
aatatattaaaaaactattttggtagaattattgcaattgatgcatcaacaagtttatat
caatttcttattgcaatgaatgctgatgtttcttcggcattaacaaatcaacttggtgaa
actacaagtcatttacaaggtatgttttatcgtacaattaaattaatttcaagaggtatt
aaaccaatttatgtatttgatggtagtgcaccagtattaaagagtggtgaattagcaaaa
agacaagcaagaagaaaagaagcaaaagagaatttaaaggaagcaacagaggttggtacc
aatgaagaggttcagaaatttgcaaaacgtgttattacagttacacgtaaacaaaatgaa
gattgtataaaacttttaacattaatgggtgtaccaattgtaaaggcaccatgtgaggca
gaagcgcaatgtgcagagattgtaaagaagggtaaagcatgggcaaccgggtcagaggat
atggattctttgacattaggttcaacagtactacttagacgtcttttcttttcagaagca
aagaaaatgccaattctagaatttgaattacaatcagtattggagggtttagggttaact
caagatgagtttattgatctttccattcttttaggttgtgattattgtgatagtatcaaa
ggtattggtccaaagagagcaattgagttaattcaaaaacataaatcattggaggaggta
atcaaacatttagataaatccaaatacccattaccagagtttttcccatacccagaggtg
agagaattatttaaaaatccaaatgttattccagctgatcaattaccaccttttcaatgg
aaagatccagatgttgaaggtttaaataaatttttagttgaagaaatgggtttctctgat
gttagagtcgctcaaggtattgaaaaattaaagaaatttaaaaatacaagtgttcaatct
cgtatggactcttttataactgtaattaaaaaaccagaagatccaaatgataaaaaaaag
aaagttacaaaaactccttcaaaaccttctgcaaaaacttctaaaaaatcttcatcaact
tttaaaagaaaataa

DBGET integrated database retrieval system