KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286069
Entry
DDB_G0286069      CDS       T00245                                 

Gene name
ku70
Definition
(RefSeq) ATP-dependent DNA helicase
  KO
K10884  ATP-dependent DNA helicase 2 subunit 1
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DDB_G0286069 (ku70)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ddi03041]
    DDB_G0286069 (ku70)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0286069 (ku70)
Spliceosome [BR:ddi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    DDB_G0286069 (ku70)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     DDB_G0286069 (ku70)
SSDB
Motif
Pfam: Ku Ku_N zf-CCHH Ku_C HeH Ish1 SAP
Other DBs
NCBI-GeneID: 8625436
NCBI-ProteinID: XP_637925
dictyBase: DDB_G0286069
UniProt: Q54MA9
Position
4
AA seq 909 aa
MSGTNSWLNNNNNNSNTTLTNTNTIGGTNFGINQFDGDDWDNIFDGNNGDGDGDLDGDSY
KSYQNPYSYRDCIIFLIDASKAMFEPNENNEIPFHNAVKCLIQTITDKIITSDSDLIGVC
FYNTNKKKNINDFENIYVLSDLDIPDPKIILTLEEMLENSNFTTNGLGNCQGEMPFCDAL
WTCSTMFSNIKQSGSSSGENSNNNNFKRIFLFTNEDNPNAYNDSIRNSSIQRSKDLSDLN
IQIELFSMNKSVNDKFDFSLFYQHILIFADEENYLDPTQFDASSKFSDLRFKLKRKEFKK
RSLGKLPLYIGNLNNNNNNSNSLDSQVIISTQLYNLFSHAHKSSPTLLDPKTNLPVKQLI
KNVCANTQATLLPSQIKLCYHYGGEPVIFTKDEMQTIKSIDRIGFTLLGFKPLENIKPYH
SIKHSQFIFPDDQSIKGSVLAFNALVEQMLKSGKAAICRFTPRSSSSPRMVALIPQEEIL
QSESEFNNQQLLNSLSSQQQQQQSSQQSSSSQQQQQQQQQQQQQQQQQQQQQLPSSSQQS
NNNRKIQIRPRGMHVIYLPFADDIRYPNNIGVKSDGLEIKQENIDKAKNIIKMMKIKFDE
KKFVNPGLQKHYASLQAIALERDKVEETVDNIQPDRKLIEKVIDTTQDFSDGIFPVGYAS
TVSSATSSTSSSSAKRLRDGKDLSTMDWPDMVKSGEIIKLTVDDLKSFLSNQNIKPSSKA
KKADLIDLISNLISGGNFKPDKLHLLKKDSPPLSDNTITTNGGDDDDNNRPSKKVKSTST
STTASKNTSSSSPPLVSAATMNKKAPPKKSFSVKDKNSSNNSSGGSSKANVNDEFDIDFK
NSDQDDDTDNESDVNNKATTSTTTITTTTAAPKKNNFVNNGMFDTRELCKYGKNCYRTNK
QHLDEYRHQ
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgagtggaaccaatagttggttaaacaataataacaataatagtaatacaacattaaca
aatacaaatactattggaggtacaaattttggtataaatcaatttgatggtgatgattgg
gataatatttttgatggtaataatggtgatggtgatggtgatttagatggtgatagttat
aaaagttatcaaaatccatactcttatcgtgattgtataatatttttaatagatgcatca
aaagcaatgtttgaaccaaatgaaaataatgaaatcccatttcataatgcagtaaaatgt
ttaattcaaacaattactgataaaattattacaagtgatagtgatttaattggtgtttgt
ttttataatacaaataaaaaaaaaaatataaatgattttgaaaatatatatgtattatca
gatttagatataccagatccaaagataatattaacattagaagaaatgttagagaattca
aatttcactacgaatggattgggtaattgtcaaggtgaaatgccattttgtgatgcatta
tggacatgttcaaccatgtttagtaatatcaaacaatctggatcatcatcaggtgagaat
tcaaataataataatttcaaaagaattttcttattcacaaatgaagacaatccgaatgca
tacaatgatagtattagaaattcatcgattcaacgttcaaaagatttatcagatttaaat
attcaaattgaattattctcaatgaataaatctgtgaatgataaattcgatttctcttta
ttctatcaacatattctaatatttgcagatgaagagaattatttagatccaactcaattt
gatgcaagttccaaattctctgatttaagatttaaattaaaaagaaaagaatttaaaaaa
agatcattaggtaaattaccattatatattggtaatttaaataataataataataatagc
aatagtttagatagtcaagttattatatcaactcaactttataatttattttcacatgct
cataaatcatcaccaacattattagatccaaaaacaaatttaccagttaaacaattgata
aagaatgtttgtgcaaacactcaagctactttattaccatcacaaattaaactttgttat
cattatggtggtgaacctgttatatttaccaaagatgagatgcaaacaattaaatctatc
gatagaattggtttcactttgttaggttttaaaccattggaaaacattaaaccctatcat
tcaatcaaacattcacaattcattttccctgatgatcaatcaattaaaggttcggtttta
gcattcaatgctttggttgaacaaatgttaaaatctggtaaagctgcaatttgtcgtttc
actccacgttcatcttcttcacctcgtatggttgctttaataccacaagaagagatttta
caatctgaatctgaatttaataatcaacaattattaaattcattatcatcacaacaacaa
caacaacaatcttctcaacaatcttcttcttcccaacaacaacaacaacaacaacaacaa
caacaacaacaacaacaacaacaacaacaacaacaacttccttcttcatctcaacaatca
aataataataggaaaattcaaattagaccaagaggtatgcatgttatttatttaccattt
gcagatgatattagatatccaaataatattggtgttaaaagtgatggattagagattaaa
caagaaaatattgataaagcaaagaatattattaaaatgatgaaaattaaatttgatgaa
aagaaatttgtaaatcctggacttcaaaaacattatgcttctttacaagctattgcattg
gaaagagataaagttgaagaaactgttgataatattcaaccagatagaaaattaattgaa
aaggttattgataccactcaagattttagtgatggtatattcccagttggttatgcttcg
actgtttcctcggcaacttcttctacctcatcctcttctgcaaaacgtttaagagacggt
aaagatttatctacaatggattggcctgatatggtaaagagtggtgaaatcattaaattg
acagtagacgatttaaaatcatttttatcaaatcaaaatattaaaccaagttcaaaagca
aaaaaagcagatttaatagatttaatctcaaatttaatttctggtggtaattttaaacca
gataaattacatcttttgaaaaaggattcacctcctttatctgataatacaataacaaca
aatggtggtgatgacgatgataataatagaccatctaaaaaagttaaatcaacttcaacc
tcaactactgcctccaaaaatacctcttcttcttctccacctcttgtttctgctgcaaca
atgaataaaaaagctcctccaaagaaaagtttttcagtaaaagataaaaatagtagtaat
aatagtagtggtggtagtagtaaagcaaatgttaatgacgaatttgatatcgattttaaa
aatagtgatcaagatgatgatacagataacgaatccgatgtaaataataaagccaccact
tcaaccactacaataactactacaacagcagccccaaagaaaaacaactttgtcaataat
ggtatgtttgatactagggaattatgtaaatatggtaaaaactgctatcgtacaaataaa
caacatcttgatgaatatagacatcaataa

DBGET integrated database retrieval system