KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286303
Entry
DDB_G0286303      CDS       T00245                                 

Gene name
ku80
Definition
(RefSeq) ATP-dependent DNA helicase
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DDB_G0286303 (ku80)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0286303 (ku80)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     DDB_G0286303 (ku80)
SSDB
Motif
Pfam: Ku_PK_bind Ku Ku_N Ku_C MGS
Other DBs
NCBI-GeneID: 8625560
NCBI-ProteinID: XP_637846
dictyBase: DDB_G0286303
UniProt: Q54LY5
Position
4
AA seq 796 aa
MTTTIPLKEAVVVILDIGLGMTSKDSDGTTTTTSSIEDALRSVTLLYQQKLIYGKKDQLG
LVLIGTKGTKNNLQDDGYQHITVVSDIEEPSIETLKYLENLAPGESKGDVIDSLIVAMDM
LIRKTENKKYQKRIFLVTNARDPINTEDLSIVRDQFKKIDVKLNIIGVDFLEEIEENNMD
TSNNNKNKSLKEKNEIFLREFAESVDGVLVPVKQALEMMSFFRSQSVMTRTSFRGALEIT
PELKIPVWGYLKMKQQLLPSLKKISSIAQQQIEQQQQQQQQQNKNKNNEDNEDNEEGKPN
ITLDVNQEVSYYSITDPDNEILKPDLLKGYKYGKSLIPFSKIDEDQLKYSSSKCLKVVGF
TDRKSIPIYYNMGNTEVFVSQPGDKQSEEALSSFIHALVETDQVMVVRYVKTMNGSPYLG
YMIPHVKSDYVCLYYNHLPLADDIRQYQFPPISPKNPLTRKSNIPNAEQLEATQQLIDSM
DLMKSEFDEDGDPIQMLKPRFTYNPLLQHFYQCLHHRSLHPNTQIPKLDPIIAEYINPDQ
IIMNKSKQSIKNFADKFPLTKTTVFSKTPAISGGNTNGTTSNTNNTMIGGVKYHWKDGML
IGEEINLDSYVTDDGSEAKKRKVNDFSEFSLDKLVSGYVTEVGTINPVQNFKDMLNRRDM
DLVDKAITLMKERILQLVNDSLRDQYYQKAFECIKELRVGCIRESEAEQFNGFLKDMRSL
FQSKKRDDFWQYITADVTSILGEKSINLITQDECDSSEVTQEELDQFLDKKVKQFNPPPI
TNVNTDSVDDLFDQIE
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgacaactacaataccattaaaagaagcagtggttgtaattttagatataggattaggt
atgacaagtaaagatagtgatggaacaacaacaacaacatcatcaattgaagatgcatta
agatcagttacattattatatcaacaaaaattaatatatggtaaaaaggatcaattagga
ttagttttaattggaacaaaaggtacaaaaaacaatttacaagatgatggatatcaacat
attacagttgtaagtgatattgaagaaccatcaattgaaacattgaaatatttagagaat
ttagcacctggtgaatcaaaaggtgatgtcattgattcattaatagttgcaatggatatg
ttaattagaaaaactgaaaataaaaaatatcaaaaacgtattttccttgttacaaatgca
agagatccaattaatactgaagatttatcaattgttagagatcaatttaaaaaaatagat
gtaaaattaaatataataggtgttgactttttagaagaaatagaagaaaataatatggat
acaagtaataataataaaaataaaagtttaaaagaaaagaatgaaatatttttaagagaa
tttgcagaatcagttgatggagtattagtaccagttaaacaggcattagaaatgatgagc
ttttttagatcacaatcagtaatgactcgtacaagttttagaggtgcattagaaattaca
ccagaattaaaaatacctgtatggggatatttaaaaatgaaacaacaattattaccatcc
ttaaaaaagatttcatcaatagctcaacaacaaattgagcaacaacaacaacaacaacaa
caacaaaataaaaataaaaataatgaagataatgaagataatgaagaaggtaaaccaaat
attacattagatgttaatcaagaagtatcatattatagtattacagatccagataatgaa
attttaaaaccagatttattaaaaggttataaatatggtaaatcattaataccattttca
aagattgatgaggatcaattaaaatattcatcaagtaaatgtttgaaagttgttggattc
acagatcgtaaatcaataccaatctattataatatgggtaatactgaagtatttgtatca
caacctggtgataaacaatcagaggaagcattatcatcatttatacatgcattggttgag
actgatcaagttatggtggtaagatatgtaaaaacaatgaatggatcaccttatcttggt
tatatgatcccacatgtaaagagtgattatgtttgtctatattataatcatttaccattg
gctgatgatattagacaatatcaattcccaccaatttcaccaaagaatccgttaactagg
aaatcaaatataccaaatgcagaacaattggaagcaactcaacaactcattgattcaatg
gatttaatgaaatcggaattcgatgaagatggtgacccaattcaaatgttaaaaccaaga
ttcacatacaatcctttacttcaacatttctatcaatgtcttcatcatagatctttacat
ccaaatactcaaattccaaaattggatcctataatagcagagtatattaacccagatcaa
atcattatgaataaatcaaaacaatcaattaaaaactttgcagataaattccccctcact
aaaaccactgtattctctaaaacacctgctatctctggtggcaataccaatggcacaaca
tccaatacaaacaatacaatgattggtggtgtaaaatatcattggaaagatggtatgtta
attggtgaggaaattaatttagattcctatgtcaccgatgatggttccgaggctaaaaag
agaaaggttaatgatttctcagagttttcattggataagttggtctctggttatgttaca
gaggttggtacaattaatcctgttcaaaactttaaagatatgttaaatagaagagatatg
gatcttgtggataaagcaatcactttaatgaaggaaagaatacttcaattggttaatgat
tcacttagggatcaatattatcaaaaggctttcgaatgtataaaagaattaagagttggt
tgtattagagaatcagaagctgaacaattcaatggtttcctcaaagatatgagatcttta
tttcaatcaaagaaaagagatgacttttggcaatatatcactgctgatgtaacttcaatc
cttggtgagaaatcaattaatttaatcactcaagatgaatgcgattcttctgaagttact
caagaagagttggatcaatttttggataaaaaggttaaacaattcaatcctcctccaatt
acaaatgttaatacagattcggttgatgacttattcgatcaaattgaataa

DBGET integrated database retrieval system